Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00002

Target Information
NameHemagglutinin    
Type of targetClinical trial target    
SynonymsHA    
Hemagglutinin HA1 chain    
Hemagglutinin HA2 chain    
DiseaseInfluenza A virus infection
[ICD9: 001-139, 042-075, 487, 488   ICD10: A00-B99, A80-A99, B00-B34, J10, J11]
[1]
Drug(s)ArbidolPhase IInfluenza virus infection[2][3]
UniProt IDP03437
PDB Structure1EO8; 1FYT; 1HA0; 1HGG; 1HTM; 1J8H; 1QU1; 2HMG; 2VIR; 2VIS; 2VIT; 2VIU; 2YPG; 3EYM; 3HMG; 3S4S; 3S5L; 3VUN; 4HMG; 5HMG.    
FunctionBinds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. Plays a major role in the determination of host range restriction and virulence. Class i viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low ph in endosomes induce an irreversible conformational change in ha2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.    
SequenceMKTIIALSYIFCLALGQDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQ SSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPD YASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVL NVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVR GLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITP NGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWE GMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEG RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGN GCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISC FLLCVVLLGFIMWACQRGNIRCNICI
Target ValidationClick to Find Target Validation Information.    
Inhibitor2-tert-butylbenzene-1,4-diol[4]
Alpha-D-Mannose[5]
Arbidol[2][3]
BMY-27709[1][6][7][8]
CL 385319[1][6][7][8]
Stachyflin[1][6][7][8]
TBHQ[1][6][7][8]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Structure of influenza hemagglutinin in complex with an inhibitor of membrane fusion. Proc Natl Acad Sci U S A. 2008 Nov 18;105(46):17736-41. Epub 2008 Nov 12. To Reference
Ref 2Pharmacokinetic properties and bioequivalence of two formulations of arbidol: an open-label, single-dose, randomized-sequence, two-period crossover study in healthy Chinese male volunteers. Clin Ther. 2009 Apr;31(4):784-92. To Reference
Ref 3Investigation of triazavirin antiviral activity against influenza A virus (H5N1) in cell culture. Antibiot Khimioter. 2007;52(11-12):18-20. To Reference
Ref 4Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6Novel stachyflin derivatives from Stachybotrys sp. RF-7260. Fermentation, isolation, structure elucidation and biological activities. J Antibiot (Tokyo). 2002 Mar;55(3):239-48. To Reference
Ref 7An approach to the identification of potent inhibitors of influenza virus fusion using parallel synthesis methodology. Bioorg Med Chem Lett. 2001 Sep 3;11(17):2393-6. To Reference
Ref 8Inhibition of influenza A virus replication by compounds interfering with the fusogenic function of the viral hemagglutinin. J Virol. 1999 Jan;73(1):140-51. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543