Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00009

Target Information
Name5-hydroxy-tryptamine 3B receptor    
Type of targetClinical trial target    
Synonyms5-HT-3B    
5-HT3B    
5-hydroxytryptamine receptor 3B    
HTR3B    
Serotonin receptor 3B    
DiseaseDiarrhea
[ICD9: 787.91   ICD10: A09, K59.1]
[1][2]
Irritable Bowel Syndrome (IBS)
[ICD9: 564.1   ICD10: K58]
[1][2]
Drug(s)CilansetronPhase III, Positive phase III resultsIrritable Bowel Syndrome (IBS), Diarrhea[1][2]
UniProt IDO95264
SequenceMLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY LFMLGIYTITLCSLWALWGGV
Target ValidationClick to Find Target Validation Information.    
Inhibitor2- (1H-Imidazol-4-ylmethyl)-4-phenyl-thiazole[3]
2- (4-Benzyl-piperazin-1-yl)-benzothiazole[4]
2- (4-Methyl-piperazin-1-yl)-quinoline[5]
3- (2-Amino-ethyl)-2-methyl-1H-indol-5-ol[3]
6- (4-Methyl-piperazin-1-yl)-phenanthridine[5]
BEMESETRON[6]
BRL-24682[7]
BRL-46470[8]
MESULERGINE[9]
ML-10302[10]
PHA-543613[11]
QUIPAZINE[5]
SC-52491[12]
SC-53116[12]
SDZ-205557[10]
SEROTONIN[5]
ZACOPRIDE[10]
AntagonistCilansetron[1][2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Efficacy of 5-HT3 antagonists and 5-HT4 agonists in irritable bowel syndrome: systematic review and meta-analysis. Am J Gastroenterol. 2009 Jul;104(7):1831-43; quiz 1844. Epub 2009 May 26. To Reference
Ref 2Serotonin receptor modulators in the treatment of irritable bowel syndrome. Ther Clin Risk Manag. 2008 Feb;4(1):41-8. To Reference
Ref 3J Med Chem. 1990 Jan;33(1):13-6.Aromatic thiazole derivatives: structurally novel and selective serotonin-3 receptor antagonists. To Reference
Ref 4J Med Chem. 1994 Apr 29;37(9):1320-5.Synthesis of 2-piperazinylbenzothiazole and 2-piperazinylbenzoxazole derivatives with 5-HT3 antagonist and 5-HT4 agonist properties. To Reference
Ref 5J Med Chem. 1999 May 6;42(9):1556-75.Novel potent and selective central 5-HT3 receptor ligands provided with different intrinsic efficacy. 2. Molecular basis of the intrinsic efficacy of arylpiperazine derivatives at the central 5-HT3 receptors. To Reference
Ref 6J Med Chem. 1992 Jan 24;35(2):310-9.Zatosetron, a potent, selective, and long-acting 5HT3 receptor antagonist: synthesis and structure-activity relationships. To Reference
Ref 7J Med Chem. 2003 Feb 27;46(5):702-15.Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotonin 5-HT3 and dopamine D2 receptor antagonistic activity. To Reference
Ref 8J Med Chem. 1997 Oct 10;40(21):3369-80.Phenylimidazolidin-2-one derivatives as selective 5-HT3 receptor antagonists and refinement of the pharmacophore model for 5-HT3 receptor binding. To Reference
Ref 9J Med Chem. 1997 Oct 24;40(22):3670-8.Novel and highly potent 5-HT3 receptor agonists based on a pyrroloquinoxaline structure. To Reference
Ref 10Bioorg. Med. Chem. Lett. 4(12):1433-1436 (1994) To Reference
Ref 11J Med Chem. 2006 Jul 13;49(14):4425-36.Discovery of N-[(3R)-1-azabicyclo[2.2.2]oct-3-yl]furo[2,3-c]pyridine-5-carboxamide, an agonist of the alpha7 nicotinic acetylcholine receptor, for the potential treatment of cognitive deficits in schizophrenia: synthesis and structure--activity relationship. To Reference
Ref 12J Med Chem. 2006 Feb 9;49(3):1125-39.Pyrrolizidine esters and amides as 5-HT4 receptor agonists and antagonists. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543