Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00017

Target Information
NameCalcitonin gene-related peptide 1    
Type of targetClinical trial target    
SynonymsAlpha-type CGRP    
CALC1    
CALCA    
CGRP-I    
Calcitonin gene-related peptide I    
DiseaseMigraine and Cluster Headaches
[ICD9: 339.00, 339.01, 339.02, 346   ICD10: G43, G44.0]
[1][2][3]
Drug(s)CizolirtinePhase IINeuropathic pain[4]
OlcegepantDiscontinued in Phase I/IIMigraine and Cluster Headaches[1][2][3]
UniProt IDP06881
PDB Structure1LS7.    
SequenceMGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG RRRRDLQA
Target ValidationClick to Find Target Validation Information.    
InhibitorAc-VTHRLAGLLSRSGGVVKNNFVPTDVGPFAF-NH2[5]
Ac-VTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2[5]
Ac-WVEHRLKGELSRKGGVV[hArg]KNFVPTDVGPFAF-NH2[5]
Ac-WVTHQLAGLLSQSGGVVRKNFVPTDVGPFAF-NH2[5]
Ac-WVTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2[5]
Ac-WVTHRLAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2[5]
Ac-WVTH[Cit]LAGLLSRSGGVVRKNFVPTDVGPFAF-NH2[5]
Ac-WVTH[Cit]LAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2[5]
Ac-WVTH[hArg]LAGLLS[hArg]SGGVVRKNFVPTDVGPFAF-NH2[5]
Cizolirtine[4]
Olcegepant[1][2][3]
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2[5]
WVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2[5]
[Aib29,Asp31,Pro34,Phe35]CGRP (27-37)[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Role of calcitonin gene-related peptide in light-aversive behavior: implications for migraine. J Neurosci. 2009 Jul 8;29(27):8798-804. To Reference
Ref 2Future drugs for migraine. Intern Emerg Med. 2009 Jun 24. [Epub ahead of print] To Reference
Ref 3CGRP antagonists: novel concept for treatment of migraine. Med Monatsschr Pharm. 2009 May;32(5):182-5. To Reference
Ref 4Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. To Reference
Ref 5J Med Chem. 2008 Dec 25;51(24):7889-97.Identification of potent, selective, and metabolically stable peptide antagonists to the calcitonin gene-related peptide (CGRP) receptor. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543