Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00040

Target Information
NameNeuropeptide Y receptor type 2    
Type of targetClinical trial target    
SynonymsNPY-Y2 receptor    
NPY2-R    
NPY2R    
Y2 receptor    
DiseaseObesity
[ICD9: 278   ICD10: E66]
[1]
Drug(s)AC-162352Discontinued in Phase IObesity[2]
PYY3-36Discontinued in Phase IIObesity[2]
TM30338Discontinued in Phase IIObesity[3]
BIBO-3304PreclinicalObesity[2]
BMS-192548PreclinicalObesity[2]
PathwayNeuroactive ligand-receptor interaction
UniProt IDP49146
PDB Structure2IK3.    
SequenceMGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK KNLEVRKNSGPNDSFTEATNV
Target ValidationClick to Find Target Validation Information.    
InhibitorAcNPY (25-36)[4]
AcPYY (22-36)[4]
AcPYY (25-36)[4]
AcPYY (26-36)[4]
Adp[-Trp-Arg-Nva-Arg-Tyr-NH2]2[5]
ECONAZOLE NITRATE[6]
H-[Trp-Arg-Nva-Arg-Tyr]2-NH2[5]
H-[Trp-Arg-Nva-Arg-Tyr]3-NH2[5]
LRHYLNLLTRQRY-NH2[7]
NEUROPEPTIDE-Y[8]
PYY (22-36)[4]
PYY (25-36)[4]
PYY (3-36)[4]
Pim[-Trp-Arg-Nva-Arg-Tyr-NH2]2[5]
Sub[-Trp-Arg-Nva-Arg-Tyr-NH2]2[5]
Sub[-Tyr-Arg-Leu-Arg-Tyr-NH2]2[5]
AgonistAC-162352[2]
PYY3-36[2]
TM30338[3]
AntagonistBIBO-3304[2]
BMS-192548[2]
MultitargetTM30338[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008. To Reference
Ref 2Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. To Reference
Ref 3Neuropeptide y receptor selective ligands in the treatment of obesity. Endocr Rev. 2007 Oct;28(6):664-84. To Reference
Ref 4Bioorg Med Chem Lett. 2007 Jan 15;17(2):538-41. Epub 2006 Oct 7.Identification of selective neuropeptide Y2 peptide agonists. To Reference
Ref 5J Med Chem. 2006 Apr 20;49(8):2661-5.Neuropeptide Y (NPY) Y4 receptor selective agonists based on NPY(32-36): development of an anorectic Y4 receptor selective agonist with picomolar affinity. To Reference
Ref 6Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). To Reference
Ref 7Bioorg Med Chem Lett. 2007 Apr 1;17(7):1916-9. Epub 2007 Jan 24.A long-acting selective neuropeptide Y2 receptor PEGylated peptide agonist reduces food intake in mice. To Reference
Ref 8J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543