Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00042

Target Information
NameMatrix metalloproteinase-14    
Type of targetDiscontinued target    
SynonymsMMP-14    
MMP-X1    
MMP14    
MT-MMP 1    
MT1-MMP    
MT1MMP    
MTMMP1    
Membrane-type matrix metalloproteinase 1    
Membrane-type-1 matrix metalloproteinase    
DiseaseBrain Cancer
[ICD9: 191   ICD10: C71]
[1][2][3]
Hormone-refractory Prostate cancer
[ICD9: 185   ICD10: C61]
[4][5]
Kaposi's Sarcoma
[ICD9: 176   ICD10: C46]
[4][5]
Lung Cancer
[ICD9: 162   ICD10: C33-C34]
[6][7][8]
Myocardial infarction (MI)
[ICD9: 410   ICD10: I21, I22]
[9]
Non-small Cell Lung Cancer
[ICD9: 162   ICD10: C33, C34]
[4][5]
Osteoarthritis
[ICD9: 715   ICD10: M15-M19, M47]
[9]
Pancreatic Cancer
[ICD9: 157   ICD10: C25]
[6][7][8]
Prostate cancer
[ICD9: 185   ICD10: C61]
[1][2][3]
EC NumberEC 3.4.24.80
PathwayGnRH signaling pathway
UniProt IDP50281
PDB Structure1BQQ; 1BUV; 3C7X; 3MA2.    
SequenceMSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Target ValidationClick to Find Target Validation Information.    
Inhibitor2- (4-bromophenylsulfonamido)-N-hydroxyacetamide[10]
2- (Biphenyl-4-ylsulfonyl)N-hydroxybenzamide[11]
2- (biphenyl-4-ylsulfonamido)-N-hydroxyacetamide[10]
CGS-27023A[12]
CGS-27023A[10]
EPIGALOCATECHIN GALLATE[13]
IK-682[14]
ILOMASTAT[15]
N-Hydroxy-2- (4-phenoxy-benzenesulfonyl)benzamide[11]
N-hydroxy-2- (4-methoxyphenylsulfonamido)acetamide[10]
SR-973[16]
UK-356618[17]
[2- (Biphenyl-4-sulfonyl)phenyl]acetic Acid[11]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Inhibition of gelatinase activity reduces neural injury in an ex vivo model of hypoxia-ischemia. Neuroscience. 2009 Jun 2;160(4):755-66. Epub 2009 Mar 9. To Reference
Ref 2Delayed administration of a matrix metalloproteinase inhibitor limits progressive brain injury after hypoxia-ischemia in the neonatal rat. J Neuroinflammation. 2008 Aug 11;5:34. To Reference
Ref 3Pharmacoproteomics of a metalloproteinase hydroxamate inhibitor in breast cancer cells: dynamics of membrane type 1 matrix metalloproteinase-mediated membrane protein shedding. Mol Cell Biol. 2008 Aug;28(15):4896-914. Epub 2008 May 27. To Reference
Ref 4Phase 1/2 trial of BMS-275291 in patients with human immunodeficiency virus-related Kaposi sarcoma: a multicenter trial of the AIDS Malignancy Consortium. Cancer. 2008 Mar 1;112(5):1083-8. To Reference
Ref 5Randomized phase II feasibility study of combining the matrix metalloproteinase inhibitor BMS-275291 with paclitaxel plus carboplatin in advanced non-small cell lung cancer. Lung Cancer. 2004 Dec;46(3):361-8. To Reference
Ref 6Novel investigational drugs for gastric cancer. Expert Opin Investig Drugs. 2009 Jul;18(7):945-55. To Reference
Ref 7Matrix metalloproteinase-2 involvement in breast cancer progression: a mini-review. Med Sci Monit. 2009 Feb;15(2):RA32-40. To Reference
Ref 8Matrix metalloproteinase inhibition as a novel anticancer strategy: a review with special focus on batimastat and marimastat. Pharmacol Ther. 1997;75(1):69-75. To Reference
Ref 9Am J Physiol Heart Circ Physiol. 2006 Jun;290(6):H2522-7. Epub 2006 Jan 20.Selective matrix metalloproteinase inhibition attenuates progression of left ventricular dysfunction and remodeling in dogs with chronic heart failure. To Reference
Ref 10J Med Chem. 2010 Mar 25;53(6):2622-35.Potent arylsulfonamide inhibitors of tumor necrosis factor-alpha converting enzyme able to reduce activated leukocyte cell adhesion molecule shedding in cancer cell models. To Reference
Ref 11J Med Chem. 2009 Oct 22;52(20):6347-61.Design, synthesis, biological evaluation, and NMR studies of a new series of arylsulfones as selective and potent matrix metalloproteinase-12 inhibitors. To Reference
Ref 12Bioorg Med Chem. 2007 Feb 1;15(3):1266-74. Epub 2006 Nov 14.Methotrexate gamma-hydroxamate derivatives as potential dual target antitumor drugs. To Reference
Ref 13Bioorg Med Chem Lett. 2009 Aug 1;19(15):4171-4. Epub 2009 Jun 2.Regioselective synthesis of methylated epigallocatechin gallate via nitrobenzenesulfonyl (Ns) protecting group. To Reference
Ref 14J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. To Reference
Ref 15Bioorg Med Chem. 2008 Sep 15;16(18):8745-59. Epub 2008 Jul 20.Introduction of the 4-(4-bromophenyl)benzenesulfonyl group to hydrazide analogs of Ilomastat leads to potent gelatinase B (MMP-9) inhibitors with improved selectivity. To Reference
Ref 16Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. To Reference
Ref 17J Med Chem. 2003 Jul 31;46(16):3514-25.A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543