Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00043

Target Information
NameNeuropeptide Y receptor type 4    
Type of targetClinical trial target    
SynonymsNPY4-R    
NPY4R    
PP1    
PPYR1    
Pancreatic polypeptide receptor 1    
DiseaseObesity
[ICD9: 278   ICD10: E66]
[1]
Schizophrenia and Schizoaffective Disorders
[ICD9: 295, 295.70   ICD10: F20, F25]
[1]
Drug(s)TM30339Phase I/IISchizophrenia, Schizoaffective Disorders[2]
TM30338Discontinued in Phase IIObesity[2]
PathwayNeuroactive ligand-receptor interaction
UniProt IDP50391
PDB Structure2IK5.    
SequenceMNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRR LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE VSKGSLRLSGRSNPI
Target ValidationClick to Find Target Validation Information.    
InhibitorAdp[-Trp-Arg-Nva-Arg-Tyr-NH2]2[3]
H-[Trp-Arg-Nva-Arg-Tyr]2-NH2[3]
H-[Trp-Arg-Nva-Arg-Tyr]3-NH2[3]
Pim[-Trp-Arg-Nva-Arg-Tyr-NH2]2[3]
Sub[-Trp-Arg-Nva-Arg-Tyr-NH2]2[3]
Sub[-Tyr-Arg-Leu-Arg-Tyr-NH2]2[3]
[Cys-Trp-Arg-Nva-Arg-Tyr-NH2]2[3]
AgonistTM30338[2]
TM30339[2]
MultitargetTM30338[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008. To Reference
Ref 2Neuropeptide y receptor selective ligands in the treatment of obesity. Endocr Rev. 2007 Oct;28(6):664-84. To Reference
Ref 3J Med Chem. 2006 Apr 20;49(8):2661-5.Neuropeptide Y (NPY) Y4 receptor selective agonists based on NPY(32-36): development of an anorectic Y4 receptor selective agonist with picomolar affinity. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543