Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00048

Target Information
NameInduced myeloid leukemia cell differentiation protein Mcl-1    
Type of targetClinical trial target    
SynonymsBcl-2-related protein EAT/mcl1    
mcl1/EAT    
DiseaseLeukemia, Lymphoid
[ICD9: 208.9   ICD10: C91-C95]
[1][2]
Lymphoma, Non-Hodgkin's
[ICD9: 202.8   ICD10: C81-C96]
[1][2]
Prostate cancer
[ICD9: 185   ICD10: C61]
[1][2]
Drug(s)AT-101Phase IILymphoid Leukemia, Non-Hodgkin's Lymphoma, Prostate Cancer[2]
UniProt IDQ07820
PDB Structure2KBW; 2NL9; 2NLA; 2PQK; 3D7V; 3IO9; 3KJ0; 3KJ1; 3KJ2; 3KZ0; 3MK8; 3PK1; 3TWU; 4HW2; 4HW3; 4HW4.    
SequenceMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Target ValidationClick to Find Target Validation Information.    
InhibitorALTENUSIN[3]
AMENTOFLAVONE[3]
AT-101[2]
BITHIONOL[3]
CEPHALOCHROMIN[3]
GNF-PF-1591[3]
GNF-PF-3955[3]
GNF-PF-5134[3]
LIOTHYRONINE SODIUM[3]
MORIN[3]
NSC-180246[3]
NSC-66209[3]
QEDIIRNIARHLAQVGDSMDR[4]
ROSMARINIC ACID[3]
SULFURETIN[3]
TW-37[4]
MultitargetAT-101[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Mcl1 downregulation sensitizes neuroblastoma to cytotoxic chemotherapy and small molecule Bcl2-family antagonists. Cancer Biol Ther. 2009 Aug 8;8(16). [Epub ahead of print] To Reference
Ref 2An open-label, multicenter, phase I/II study of single-agent AT-101 in men with castrate-resistant prostate cancer. Clin Cancer Res. 2009 May 1;15(9):3172-6. Epub 2009 Apr 14. To Reference
Ref 3Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). To Reference
Ref 4J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543