Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00098

Target Information
NameE-selectin    
Type of targetClinical trial target    
SynonymsCD62E    
CD62E antigen    
ELAM-1    
Endothelial leukocyte adhesion molecule 1    
LECAM2    
Leukocyte-endothelial cell adhesion molecule 2    
DiseaseAsthma
[ICD9: 493   ICD10: J45]
[1][2][3]
Atopic Dermatitis
[ICD9: 691.8   ICD10: L20]
[1][2][3]
Chronic Obstructive Pulmonary Disease (COPD)
[ICD9: 490-492, 494-496   ICD10: J40-J44, J47]
[1][2][3]
Inflammatory skin disorder[4]
Ischemic stroke
[ICD9: 434.91   ICD10: I61-I63]
[5]
Psoriasis and Psoriatic Disorders
[ICD9: 696   ICD10: L40]
[1][2][3]
Drug(s)BimosiamosePhase IIa completedPsoriasis and Psoriatic Disorders, Atopic Dermatitis[1][2][3]
BimosiamosePhase IIaChronic Obstructive Pulmonary Disease[1][2][3]
BimosiamosePhase IIAsthma[1][2][3]
BimosiamosePhase IIInflammatory Disorders[1][2][3]
BioChemical ClassGrowth factor    
PathwayCell adhesion molecules (CAMs)
UniProt IDP16581
PDB Structure1ESL; 1G1T; 1KJA.    
FunctionExpressed on cytokine induced endothelial cells and mediates their binding to leukocytes. The ligand recognized by elam-1 is sialyl-lewis x (alpha(1->3)fucosylated derivatives of polylactosamine that are found at the nonreducing termini of glycolipids).    
SequenceMIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD GSYQKPSYIL
Target ValidationClick to Find Target Validation Information.    
Inhibitor1na[6]
Bimosiamose[1][2][3]
Efomycine M[4]
Fucose[6]
O-Sialic Acid[7]
AntibodyMonoclonal antibodies[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Effects of the pan-selectin antagonist bimosiamose (TBC1269) in experimental human endotoxemia. Shock. 2008 Apr;29(4):475-82. To Reference
Ref 2The pharmacokinetics of subcutaneously injected Bimosiamose disodium in healthy male volunteers. Biopharm Drug Dispos. 2007 Dec;28(9):475-84. To Reference
Ref 3Bimosiamose, an inhaled small-molecule pan-selectin antagonist, attenuates late asthmatic reactions following allergen challenge in mild asthmatics: a randomized, double-blind, placebo-controlled clinical cross-over-trial. Pulm Pharmacol Ther. 2006;19(4):233-41. Epub 2005 Sep 1. To Reference
Ref 4Interfering with leukocyte rolling--a promising therapeutic approach in inflammatory skin disorders? Trends Pharmacol Sci. 2003 Feb;24(2):49-52. To Reference
Ref 5Demonstration of increased endothelial-leukocyte adhesion molecule-1 mRNA expression in rat ischemic cortex. Stroke. 1995 Sep;26(9):1665-8; discussion 1668-9. To Reference
Ref 6Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 7Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543