Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00143

Target Information
NameKinesin-like protein KIF11    
Type of targetClinical trial target    
SynonymsEg5    
Kinesin-like protein 1    
Kinesin-like spindle protein HKSP    
Kinesin-related motor protein Eg5    
TRIP5    
Thyroid receptor interacting protein 5    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1][2][3]
Head and Neck Cancer
[ICD9: 140-149   ICD10: C07-C14, C32-C33]
[4][5][6]
Lung Cancer
[ICD9: 162   ICD10: C33-C34]
[4][5][6]
Lymphoma, Non-Hodgkin's
[ICD9: 202.8   ICD10: C81-C96]
[7]
Ovarian cancer
[ICD9: 183   ICD10: C56]
[4][5][6]
Pediatric[4][5][6]
Renal Cell Carcinoma
[ICD9: 189   ICD10: C64]
[4][5][6]
Solid tumors
[ICD9: 140-199, 210-229   ICD10: C00-C75, C7A, C7B, D10-D36, D3A]
[4][5][6]
Drug(s)IspinesibPhase II completedLung Cancer[4][5][6]
IspinesibPhase IIHead and Neck Cancer, Renal Cell Carcinoma, Ovarian Cancer, Solid Tumors[4][5][6]
SB-743921Phase I/IINon-Hodgkin's Lymphoma, Cancer/Tumors[7]
4SC-205Phase ISolid tumour and malignant lymphoma[8]
ARQ 621Phase IHematological malignancies (see also solid tumors)
ARQ 621Phase ILate-stage solid tumors (see also other)
ARRY-520Phase ICancer/Tumors[1][2]
BQS481Phase ISolid Tumors
IspinesibPhase IPediatric[4][5][6]
UniProt IDP52732
PDB Structure1II6; 1Q0B; 1X88; 1YRS; 2FKY; 2FL2; 2FL6; 2FME; 2G1Q; 2GM1; 2IEH; 2PG2; 2Q2Y; 2Q2Z; 2UYI; 2UYM; 2WOG; 2X2R; 2X7C; 2X7D; 2X7E; 2XAE; 3CJO; 3HQD; 3K3B; 3K5E; 3KEN; 3L9H; 3ZCW; 4A1Z; 4A28; 4A50; 4A51; 4A5Y; 4AP0; 4AQV; 4AQW; 4AS7; 4BBG.    
FunctionMotor protein required for establishing a bipolar spindle. Blocking of eg5 prevents centrosome migration and arrest cells in mitosis with monoastral microtubule arrays.    
SequenceMASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Target ValidationClick to Find Target Validation Information.    
Inhibitor4SC-205[8]
ARRY-520[1][2]
Adenosine-5'-Diphosphate[9]
Ispinesib[4][5][6]
Monastrol[10]
SB-743921[7]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Inhibition of KSP by ARRY-520 induces cell cycle block and cell death via the mitochondrial pathway in AML cells. Leukemia. 2009 May 21. [Epub ahead of print] To Reference
Ref 2Gateways to clinical trials. Methods Find Exp Clin Pharmacol. 2007 Nov;29(9):625-55. To Reference
Ref 3Phenotypic screening of small molecule libraries by high throughput cell imaging. Comb Chem High Throughput Screen. 2003 Jun;6(4):279-86. To Reference
Ref 4Initial testing (stage 1) of the kinesin spindle protein inhibitor ispinesib by the pediatric preclinical testing program. Pediatr Blood Cancer. 2009 Jun 24. [Epub ahead of print] To Reference
Ref 5KIF11 inhibition for glioblastoma treatment: reason to hope or a struggle with the brain? BMC Cancer. 2009 Jun 22;9:196. To Reference
Ref 6Gateways to clinical trials. July-August 2008. Methods Find Exp Clin Pharmacol. 2008 Jul-Aug;30(6):459-95. To Reference
Ref 7Gateways to clinical trials. Methods Find Exp Clin Pharmacol. 2009 Jan-Feb;31(1):47-57. To Reference
Ref 82011 Pipeline of 4SC AG. To Reference
Ref 9Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 10Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543