Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00145

Target Information
NameRibosomal protein S6 kinase    
Type of targetDiscontinued target    
SynonymsP70-S6K    
S6K    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
Solid tumors
[ICD9: 140-199, 210-229   ICD10: C00-C75, C7A, C7B, D10-D36, D3A]
[2]
Drug(s)XL418Suspended in Phase ISolid Tumors[3]
BioChemical ClassTransferases transferring phosphorus-containing groups    
EC NumberEC 2.7.1.-
EC 2.7.1.37
PathwayAcute myeloid leukemia
ErbB signaling pathway
Insulin signaling pathway
TGF-beta signaling pathway
mTOR signaling pathway
UniProt IDP23443
PDB Structure3A60; 3A61; 3A62.    
FunctionPhosphorylates specifically ribosomal protein s6.    
SequenceMRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Target ValidationClick to Find Target Validation Information.    
Inhibitor4,5,6,7-tetrabromobenzotriazole[4]
4-[ (3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol[5]
BISINDOLYLMALEIMIDE IX[6]
CI-1040,   PD-18435,   PD-184352[6]
KN-62[6]
KT-5720[6]
LY-294002[6]
PD-98059[6]
PHA-767491[7]
RO-316233[6]
SB-202190[6]
SB-203580[6]
SB-415286[8]
SB-747651A[9]
STAUROSPORINONE[6]
U-0126[6]
XL418[3]
MultitargetXL418[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Identification of novel cellular targets in biliary tract cancers using global gene expression technology. Am J Pathol. 2003 Jul;163(1):217-29. To Reference
Ref 2CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008. To Reference
Ref 3Drug information of XL418. National Cancer Institute. 2009 To Reference
Ref 4J Med Chem. 2004 Dec 2;47(25):6239-47.Optimization of protein kinase CK2 inhibitors derived from 4,5,6,7-tetrabromobenzimidazole. To Reference
Ref 5J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. To Reference
Ref 6Biochem J. 2000 Oct 1;351(Pt 1):95-105.Specificity and mechanism of action of some commonly used protein kinase inhibitors. To Reference
Ref 7J Med Chem. 2007 May 31;50(11):2647-54. Epub 2007 May 5.Pyrrolopyridine inhibitors of mitogen-activated protein kinase-activated protein kinase 2 (MK-2). To Reference
Ref 8Bioorg Med Chem Lett. 2001 Mar 12;11(5):635-9.3-Anilino-4-arylmaleimides: potent and selective inhibitors of glycogen synthase kinase-3 (GSK-3). To Reference
Ref 9Bioorg Med Chem Lett. 2005 Jul 15;15(14):3407-11.(1H-imidazo[4,5-c]pyridin-2-yl)-1,2,5-oxadiazol-3-ylamine derivatives: further optimisation as highly potent and selective MSK-1-inhibitors. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543