Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00150

Target Information
NameCollagenase 3    
Type of targetDiscontinued target    
SynonymsCollagenase-3    
MMP-13    
Matrix metalloproteinase 13    
Matrix metalloproteinase-13    
DiseaseBrain Cancer
[ICD9: 191   ICD10: C71]
[1][2][3]
Hormone-refractory Prostate cancer
[ICD9: 185   ICD10: C61]
[4][5]
Kaposi's Sarcoma
[ICD9: 176   ICD10: C46]
[4][5]
Lung Cancer
[ICD9: 162   ICD10: C33-C34]
[1][2][3]
Myocardial infarction (MI)
[ICD9: 410   ICD10: I21, I22]
[6]
Non-small Cell Lung Cancer
[ICD9: 162   ICD10: C33, C34]
[4][5]
Osteoarthritis
[ICD9: 715   ICD10: M15-M19, M47]
[6][7]
Prostate cancer
[ICD9: 185   ICD10: C61]
[1][2][3]
Squamous cell carcinoma
[ICD9: 199   ICD10: C44]
[8]
BioChemical ClassHydrolases acting on peptide bonds (Peptidases)    
EC NumberEC 3.4.24.-
UniProt IDP45452
PDB Structure1EUB; 1FLS; 1FM1; 1PEX; 1UC1; 1XUC; 1XUD; 1XUR; 1YOU; 1ZTQ; 2D1N; 2E2D; 2OW9; 2OZR; 2PJT; 2YIG; 3ELM; 3I7G; 3I7I; 3KEC; 3KEJ; 3KEK; 3KRY; 3LJZ; 3O2X; 3TVC; 3ZXH; 456C; 4A7B; 830C.    
FunctionDegrades collagen type i. Does not act on gelatin or casein. Could have a role in tumoral process.    
SequenceMHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Related US Patent6,265,432
6,350,885
6,350,907
6,399,612
6,420,408
6,492,422
6,541,489
6,624,196
6,656,932
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor (+/-)5-[9]
1- (4-Methoxy-benzenesulfonyl)-heptane-3-thiol[10]
1-Methyloxy-4-Sulfone-Benzene[11]
2- (2-[9]
2- (4-methoxybenzylthio)-6-methylpyrimidin-4-ol[12]
2- (Biphenyl-4-ylsulfonyl)N-hydroxybenzamide[13]
2- (biphenyl-4-ylsulfonamido)pentanedioic acid[12]
3- (4-Methoxy-benzenesulfonyl)-cyclohexanethiol[14]
3- (4-Methoxy-benzenesulfonyl)-cyclopentanethiol[14]
3- (4-Methoxy-benzenesulfonyl)-hexane-1-thiol[10]
3- (4-Methoxy-benzenesulfonyl)-pentane-1-thiol[10]
3- (4-Methoxy-benzenesulfonyl)-propane-1-thiol[10]
3- (4-Phenoxy-benzenesulfonyl)-cyclohexanethiol[14]
3- (4-Phenoxy-benzenesulfonyl)-propane-1-thiol[10]
3-Benzenesulfonyl-heptanoic acid hydroxyamide[15]
3-Cyclohexanesulfonyl-heptanoic acid hydroxyamide[15]
3-Methylpyridine[11]
4- (2,2'-bithiophen-5-ylmethyleneamino)phenol[16]
4- (4-Methoxy-benzenesulfonyl)-butane-2-thiol[10]
4- (methyl[16]
4-amino-3- (4-[12]
5- (4'-cyanobiphenyl-4-yl)-3-hydroxypentanoic acid[9]
CGS-27023A[17]
CIPEMASTAT[18]
CURCUMIN[16]
Hydroxyaminovaline[11]
IK-682[19]
ILOMASTAT[20]
N-Hydroxy-2- (4-phenoxy-benzenesulfonyl)benzamide[13]
N1,N3-bis (3-methoxybenzyl)isophthalamide[21]
N4,N6-dibenzylpyrimidine-4,6-dicarboxamide[22]
PKF-242-484,   TNF-484[18]
RS-130830[23]
Ro-32-3555[24]
Ro-37-9790[24]
SR-973[25]
TMI-05[26]
UK-356618[27]
WAY-151693[11]
[2- (Biphenyl-4-sulfonyl)phenyl]acetic Acid[13]
ethyl 2-cyano-2- (quinoxalin-2[16]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Inhibition of gelatinase activity reduces neural injury in an ex vivo model of hypoxia-ischemia. Neuroscience. 2009 Jun 2;160(4):755-66. Epub 2009 Mar 9. To Reference
Ref 2Delayed administration of a matrix metalloproteinase inhibitor limits progressive brain injury after hypoxia-ischemia in the neonatal rat. J Neuroinflammation. 2008 Aug 11;5:34. To Reference
Ref 3Pharmacoproteomics of a metalloproteinase hydroxamate inhibitor in breast cancer cells: dynamics of membrane type 1 matrix metalloproteinase-mediated membrane protein shedding. Mol Cell Biol. 2008 Aug;28(15):4896-914. Epub 2008 May 27. To Reference
Ref 4Phase 1/2 trial of BMS-275291 in patients with human immunodeficiency virus-related Kaposi sarcoma: a multicenter trial of the AIDS Malignancy Consortium. Cancer. 2008 Mar 1;112(5):1083-8. To Reference
Ref 5Randomized phase II feasibility study of combining the matrix metalloproteinase inhibitor BMS-275291 with paclitaxel plus carboplatin in advanced non-small cell lung cancer. Lung Cancer. 2004 Dec;46(3):361-8. To Reference
Ref 6Am J Physiol Heart Circ Physiol. 2006 Jun;290(6):H2522-7. Epub 2006 Jan 20.Selective matrix metalloproteinase inhibition attenuates progression of left ventricular dysfunction and remodeling in dogs with chronic heart failure. To Reference
Ref 7Impairment of the collagenase-3 endocytotic receptor system in cells from patients with osteoarthritis. Osteoarthritis Cartilage. 2003 Dec;11(12):854-63. To Reference
Ref 8Targeted inhibition of human collagenase-3 (MMP-13) expression inhibits squamous cell carcinoma growth in vivo. Oncogene. 2004 Jul 1;23(30):5111-23. To Reference
Ref 9Bioorg Med Chem Lett. 2009 Oct 1;19(19):5760-3. Epub 2009 Aug 6.The identification of beta-hydroxy carboxylic acids as selective MMP-12 inhibitors. To Reference
Ref 10Bioorg Med Chem Lett. 1999 Apr 5;9(7):943-8.Discovery of a novel series of selective MMP inhibitors: identification of the gamma-sulfone-thiols. To Reference
Ref 11Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 12Bioorg Med Chem. 2009 Feb 1;17(3):1101-8. Epub 2008 Mar 8.Ranking the selectivity of PubChem screening hits by activity-based protein profiling: MMP13 as a case study. To Reference
Ref 13J Med Chem. 2009 Oct 22;52(20):6347-61.Design, synthesis, biological evaluation, and NMR studies of a new series of arylsulfones as selective and potent matrix metalloproteinase-12 inhibitors. To Reference
Ref 14Bioorg Med Chem Lett. 1999 Jul 5;9(13):1757-60.Synthesis and identification of conformationally constrained selective MMP inhibitors. To Reference
Ref 15J Med Chem. 2000 Jun 15;43(12):2324-31.Hydroxamic acid derivatives as potent peptide deformylase inhibitors and antibacterial agents. To Reference
Ref 16Bioorg Med Chem. 2009 Feb 1;17(3):990-1005. Epub 2008 Mar 6.High throughput screening of potentially selective MMP-13 exosite inhibitors utilizing a triple-helical FRET substrate. To Reference
Ref 17Bioorg Med Chem Lett. 2001 Apr 23;11(8):1009-13.Heterocycle-based MMP inhibitors with P2' substituents. To Reference
Ref 18Bioorg Med Chem Lett. 2006 May 15;16(10):2632-6. Epub 2006 Mar 3.A cassette-dosing approach for improvement of oral bioavailability of dual TACE/MMP inhibitors. To Reference
Ref 19J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. To Reference
Ref 20J Biol Chem. 2007 Sep 21;282(38):27781-91. Epub 2007 Jul 10.Discovery and characterization of a novel inhibitor of matrix metalloprotease-13 that reduces cartilage damage in vivo without joint fibroplasia side effects. To Reference
Ref 21Bioorg Med Chem Lett. 2010 Jan 15;20(2):576-80. Epub 2009 Nov 22.Discovery of (pyridin-4-yl)-2H-tetrazole as a novel scaffold to identify highly selective matrix metalloproteinase-13 inhibitors for the treatment of osteoarthritis. To Reference
Ref 22Bioorg Med Chem Lett. 2009 Jan 1;19(1):47-50. Epub 2008 Nov 18.Calculation of binding free energies for non-zinc chelating pyrimidine dicarboxamide inhibitors with MMP-13. To Reference
Ref 23Bioorg Med Chem Lett. 2005 Feb 15;15(4):1101-6.Structure-based design of potent and selective inhibitors of collagenase-3 (MMP-13). To Reference
Ref 24Bioorg. Med. Chem. Lett. 7(17):2299-2302 (1997) To Reference
Ref 25Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. To Reference
Ref 26Bioorg Med Chem Lett. 2006 Mar 15;16(6):1605-9. Epub 2006 Jan 19.Acetylenic TACE inhibitors. Part 3: Thiomorpholine sulfonamide hydroxamates. To Reference
Ref 27J Med Chem. 2003 Jul 31;46(16):3514-25.A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543