Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00169

Target Information
NameCell division protein kinase 6    
Type of targetClinical trial target    
SynonymsCDK6    
Cyclin-dependent kinase 6    
Serine/threonine protein kinase PLSTIRE    
Serine/threonine-protein kinase PLSTIRE    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
Drug(s)LY2835219Phase IICancer
PD-0332991Phase I/IIBreast Cancer[2]
LEE011Phase ILymphoma
LEE011Phase ISolid Tumors
PD-0332991Phase ILymphoma, Mantle-Cell[2]
Capridine-betaPreclinicalAdvanced Solid Tumors[3]
BioChemical ClassTransferases transferring phosphorus-containing groups    
EC NumberEC 2.7.1.37
PathwayCell cycle
Chronic myeloid leukemia
Glioma
Melanoma
Non-small cell lung cancer
Pancreatic cancer
Pathways in cancer
Small cell lung cancer
p53 signaling pathway
UniProt IDQ00534
PDB Structure1BI7; 1BI8; 1BLX; 1G3N; 1JOW; 1XO2; 2EUF; 2F2C; 3NUP; 3NUX; 4AUA; 4EZ5.    
FunctionProbably involved in the control of the cell cycle. Interacts with d-type g1 cyclins.    
SequenceMEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF QDLERCKENLDSHLPPSQNTSELNTA
Target ValidationClick to Find Target Validation Information.    
Inhibitor3,4-di- (4-methoxyphenyl)-1H-pyrrole-2,5-dione[4]
3,4-diphenyl-1H-pyrrole-2,5-dione[4]
3,7,3',4'-TETRAHYDROXYFLAVONE[5]
3- (4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione[4]
APIGENIN[6]
CHRYSIN[6]
Capridine-beta[3]
Deschloroflavopiridol[1]
FISETIN[6]
Fascaplysin[1]
Flavopiridol[7]
PD-0332991[2]
PD0183813[1]
MultitargetCapridine-beta[3]
PD-0332991[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Pharmacological inhibitors of cyclin-dependent kinases. Trends Pharmacol Sci. 2002 Sep;23(9):417-25. To Reference
Ref 2Nat Rev Drug Discov. 2009 Jul;8(7):547-66.Cell cycle kinases as therapeutic targets for cancer. To Reference
Ref 3Agreement signed with Prostagenics to develop prostate cancer treatment. Innovate Oncology, Inc.. 2005 To Reference
Ref 4J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. To Reference
Ref 5Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 6J Med Chem. 2005 Feb 10;48(3):737-43.Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin. To Reference
Ref 7Zvelebil MJ: Flavopiridol (Hoechst AG). IDrugs. 1998 Jun;1(2):241-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543