| Target
Information |
| Name | Tumor necrosis factor receptor superfamily member 5 |
| Type of target | Clinical trial target |
| Synonyms | B-cell surface antigen CD40 |
| Bp50 |
| CD40 |
| CD40L receptor |
| CDw40 |
| Disease | Cancer, unspecific
[ICD9: 140-229 ICD10: C00-C96] | [1] |
| Inflammation | [2] |
Nonsmall cell lung cancer
[ICD9: 140-229, 162, 204.0 ICD10: C00-C96, C33-C34, C91.0] | [3] |
| Drug(s) | ASKP1240 |  | US Phase-II; Japan Phase-I | Prevention of organ transplant rejection | |
| Dacetuzumab | | Phase II | Lymphoma, Large B-Cell, Diffuse; Lymphoma, Non-Hodgkin | [4][5] |
| Dacetuzumab | | Phase I completed | Lymphoma, Large B-Cell, Diffuse; Lymphoma, Non-Hodgkin | [4][5] |
| BioChemical Class | Transmembrane protein |
| Pathway | Allograft rejection |
| Asthma |
| Autoimmune thyroid disease |
| Cell adhesion molecules (CAMs) |
| Cytokine-cytokine receptor interaction |
| Primary immunodeficiency |
| Systemic lupus erythematosus |
| Toll-like receptor signaling pathway |
| UniProt ID | P25942 |
| PDB Structure | 1CDF; 1CZZ; 1D00; 1FLL; 1LB6; 3QD6. |
| Function | Receptor for tnfsf5/cd40l. |
| Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
|
| Target Validation | Click to Find Target Validation Information. |
| Antibody | Dacetuzumab | | [4][5] |
| Ligand | CD154 | | [6] |
| RhuCD40L | | [1] |
| Cross References |
3D Structure
Related Literature
On-Line
Medical Dictionary |
| Ref 1 | Recombinant CD40 ligand therapy has significant antitumor effects on CD40-positive ovarian tumor xenografts grown in SCID mice and demonstrates an augmented effect with cisplatin. Cancer Res. 2001 Oct 15;61(20):7556-62. To Reference |
| Ref 2 | Elevated plasma levels of the atherogenic mediator soluble CD40 ligand in diabetic patients: a novel target of thiazolidinediones. Circulation. 2003 Jun 3;107(21):2664-9. Epub 2003 May 12. To Reference |
| Ref 3 | CD40-CD40 ligand (CD154) engagement is required but not sufficient for modulating MHC class I, ICAM-1 and Fas expression and proliferation of human non-small cell lung tumors. Int J Cancer. 2001 May 15;92(4):589-99. To Reference |
| Ref 4 | Roche. Product Development Pipeline. July 29 2009. To Reference |
| Ref 5 | 2011 Pipeline of Seattle Genetics. To Reference |
| Ref 6 | Growth-inhibitory effects of CD40 ligand (CD154) and its endogenous expression in human breast cancer. Clin Cancer Res. 2001 Mar;7(3):691-703. To Reference |
