Target
Information |
Name | Tumor necrosis factor receptor superfamily member 5 |
Type of target | Clinical trial target |
Synonyms | B-cell surface antigen CD40 |
Bp50 |
CD40 |
CD40L receptor |
CDw40 |
Disease | Cancer, unspecific [ICD9: 140-229 ICD10: C00-C96] | [1] |
Inflammation | [2] |
Nonsmall cell lung cancer [ICD9: 140-229, 162, 204.0 ICD10: C00-C96, C33-C34, C91.0] | [3] |
Drug(s) | ASKP1240 |  | US Phase-II; Japan Phase-I | Prevention of organ transplant rejection | |
Dacetuzumab |  | Phase II | Lymphoma, Large B-Cell, Diffuse; Lymphoma, Non-Hodgkin | [4][5] |
Dacetuzumab |  | Phase I completed | Lymphoma, Large B-Cell, Diffuse; Lymphoma, Non-Hodgkin | [4][5] |
BioChemical Class | Transmembrane protein |
Pathway | Allograft rejection |
Asthma |
Autoimmune thyroid disease |
Cell adhesion molecules (CAMs) |
Cytokine-cytokine receptor interaction |
Primary immunodeficiency |
Systemic lupus erythematosus |
Toll-like receptor signaling pathway |
UniProt ID | P25942 |
PDB Structure | 1CDF; 1CZZ; 1D00; 1FLL; 1LB6; 3QD6. |
Function | Receptor for tnfsf5/cd40l. |
Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
|
Target Validation | Click to Find Target Validation Information. |
Antibody | Dacetuzumab |  | [4][5] |
Ligand | CD154 |  | [6] |
RhuCD40L |  | [1] |
Cross References |
3D Structure
Related Literature
On-Line
Medical Dictionary |
Ref 1 | Recombinant CD40 ligand therapy has significant antitumor effects on CD40-positive ovarian tumor xenografts grown in SCID mice and demonstrates an augmented effect with cisplatin. Cancer Res. 2001 Oct 15;61(20):7556-62. To Reference |
Ref 2 | Elevated plasma levels of the atherogenic mediator soluble CD40 ligand in diabetic patients: a novel target of thiazolidinediones. Circulation. 2003 Jun 3;107(21):2664-9. Epub 2003 May 12. To Reference |
Ref 3 | CD40-CD40 ligand (CD154) engagement is required but not sufficient for modulating MHC class I, ICAM-1 and Fas expression and proliferation of human non-small cell lung tumors. Int J Cancer. 2001 May 15;92(4):589-99. To Reference |
Ref 4 | Roche. Product Development Pipeline. July 29 2009. To Reference |
Ref 5 | 2011 Pipeline of Seattle Genetics. To Reference |
Ref 6 | Growth-inhibitory effects of CD40 ligand (CD154) and its endogenous expression in human breast cancer. Clin Cancer Res. 2001 Mar;7(3):691-703. To Reference |