Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00188

Target Information
NameTumor necrosis factor receptor superfamily member 5    
Type of targetClinical trial target    
SynonymsB-cell surface antigen CD40    
Bp50    
CD40    
CD40L receptor    
CDw40    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
Inflammation[2]
Nonsmall cell lung cancer
[ICD9: 140-229, 162, 204.0   ICD10: C00-C96, C33-C34, C91.0]
[3]
Drug(s)ASKP1240US Phase-II; Japan Phase-IPrevention of organ transplant rejection
DacetuzumabPhase IILymphoma, Large B-Cell, Diffuse; Lymphoma, Non-Hodgkin[4][5]
DacetuzumabPhase I completedLymphoma, Large B-Cell, Diffuse; Lymphoma, Non-Hodgkin[4][5]
BioChemical ClassTransmembrane protein    
PathwayAllograft rejection
Asthma
Autoimmune thyroid disease
Cell adhesion molecules (CAMs)
Cytokine-cytokine receptor interaction
Primary immunodeficiency
Systemic lupus erythematosus
Toll-like receptor signaling pathway
UniProt IDP25942
PDB Structure1CDF; 1CZZ; 1D00; 1FLL; 1LB6; 3QD6.    
FunctionReceptor for tnfsf5/cd40l.    
SequenceMVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Target ValidationClick to Find Target Validation Information.    
AntibodyDacetuzumab[4][5]
LigandCD154[6]
RhuCD40L[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Recombinant CD40 ligand therapy has significant antitumor effects on CD40-positive ovarian tumor xenografts grown in SCID mice and demonstrates an augmented effect with cisplatin. Cancer Res. 2001 Oct 15;61(20):7556-62. To Reference
Ref 2Elevated plasma levels of the atherogenic mediator soluble CD40 ligand in diabetic patients: a novel target of thiazolidinediones. Circulation. 2003 Jun 3;107(21):2664-9. Epub 2003 May 12. To Reference
Ref 3CD40-CD40 ligand (CD154) engagement is required but not sufficient for modulating MHC class I, ICAM-1 and Fas expression and proliferation of human non-small cell lung tumors. Int J Cancer. 2001 May 15;92(4):589-99. To Reference
Ref 4Roche. Product Development Pipeline. July 29 2009. To Reference
Ref 52011 Pipeline of Seattle Genetics. To Reference
Ref 6Growth-inhibitory effects of CD40 ligand (CD154) and its endogenous expression in human breast cancer. Clin Cancer Res. 2001 Mar;7(3):691-703. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543