Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00209

Target Information
NameToll-like receptor 4    
Type of targetDiscontinued target    
SynonymsHToll    
TLR-4    
DiseaseLPS-induced left ventricular dysfunction
[ICD9: 428.0   ICD10: I50]
[1]
Drug(s)CS-4771Phase IAnti-sepsis
ResatorvidDiscontinuedSevere sepsis[2][3][4]
BioChemical ClassTransmembrane protein    
PathwayPathogenic Escherichia coli infection
Pathogenic Escherichia coli infection
Toll-like receptor signaling pathway
UniProt IDO00206
PDB Structure2Z62; 2Z63; 2Z65; 2Z66; 3FXI.    
FunctionCooperates with ly96 and cd14 to mediate the innate immune response to bacterial lipopolysaccharide (lps). Acts via myd88, tirap and traf6, leading to nf-kappa-b activation, cytokine secretion and the inflammatory response.    
SequenceMMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
Target ValidationClick to Find Target Validation Information.    
Inhibitor3-Hydroxy-Myristic Acid[5]
6- (2-aminophenoxy)benzo[d]isothiazol-3-amine[6]
CRX-526[7]
ERITORAN[6]
Lauric Acid[5]
MYRISTIC ACID[8]
AntagonistResatorvid[2][3][4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Escherichia coli LPS-induced LV dysfunction: role of toll-like receptor-4 in the adult heart. Am J Physiol Heart Circ Physiol. 2002 Jun;282(6):H2316-23. To Reference
Ref 2Takeda. Product Development Pipeline. July 31 2009. To Reference
Ref 3Takeda. Report of Takeda. October 18 2008. To Reference
Ref 4Eur J Pharmacol. 2008 Apr 14;584(1):40-8. Epub 2008 Feb 5.TAK-242 selectively suppresses Toll-like receptor 4-signaling mediated by the intracellular domain. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6J Med Chem. 2008 Nov 13;51(21):6621-6. Epub 2008 Oct 2.Small molecule modulators of toll-like receptors. To Reference
Ref 7Bioorg Med Chem Lett. 2008 Oct 15;18(20):5350-4. Epub 2008 Sep 19.The 'Ethereal' nature of TLR4 agonism and antagonism in the AGP class of lipid A mimetics. To Reference
Ref 8Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543