Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00219

Target Information
NameTumor necrosis factor receptor superfamily member 4    
Type of targetClinical trial target    
SynonymsACT35 antigen    
CD134 antigen    
Cell surface receptor OX40    
OX40 antigen    
OX40L receptor    
TAX-transcriptionally activated glycoprotein 1 receptor    
DiseaseAutoimmune diseases
[ICD9: 279.4   ICD10: D84.9, M35.9]
[1]
Drug(s)R4930Phase IIAsthma[2]
Anti-oxLDLPhase ISecondary prevention of cardiovascular events[3]
HuMAb OX40LPhase IAsthma[3]
BioChemical ClassTransmembrane protein    
PathwayCytokine-cytokine receptor interaction
UniProt IDP43489
PDB Structure1D0A; 2HEV; 2HEY.    
FunctionReceptor for tnfsf4/ox40l/gp34.    
SequenceMCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
Target ValidationClick to Find Target Validation Information.    
AntagonistAnti-oxLDL[3]
HuMAb OX40L[3]
R4930[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Danger and OX40 receptor signaling synergize to enhance memory T cell survival by inhibiting peripheral deletion. J Immunol. 2000 Jan 1;164(1):107-12. To Reference
Ref 2Roche. Product Development Pipeline. July 29 2009. To Reference
Ref 3Genentech. Product Development Pipeline. July 2009. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543