Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00231

Target Information
NameG-protein coupled receptor 54    
Type of targetClinical trial target    
SynonymsGPR54    
KiSS-1 receptor GPR54    
DiseaseHuman reproductive syndromes[1]
Drug(s)TAK-448Phase IProstate cancer[2][3]
TAK-683Suspended in Phase IProstate cancer[2][3]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDQ969F8
SequenceMHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Target ValidationClick to Find Target Validation Information.    
Inhibitor4-fluorobenzoyl-Phe-Gly-Leu-Arg-Trp-NH2[4]
H-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2[4]
AgonistTAK-448[2][3]
TAK-683[2][3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Biochem Biophys Res Commun. 2003 Dec 26;312(4):1357-63.The KiSS-1 receptor GPR54 is essential for the development of the murine reproductive system. To Reference
Ref 2Takeda. Product Development Pipeline. July 31 2009. To Reference
Ref 3Takeda. Report of Takeda. 2009. To Reference
Ref 4J Med Chem. 2008 Dec 11;51(23):7645-9.Development of novel G-protein-coupled receptor 54 agonists with resistance to degradation by matrix metalloproteinase. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543