Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00237

Target Information
NamePutative G-protein coupled receptor 44    
Type of targetClinical trial target    
SynonymsCD294    
Chemoattractant receptor-homologous molecule expressed on Th2 cells    
DiseaseAsthma
[ICD9: 493   ICD10: J45]
[1]
Chronic obstructive pulmonary disease
[ICD9: 490-492, 494-496   ICD10: J40-J44, J47]
[1]
Drug(s)AMG 853Phase IIIAsthma
AZD1981Phase II completedAsthma/COPD[1]
AM211Phase I completedAsthma
AZD5985Phase I completedAsthma/COPD[1]
ARRY-502Phase IAllergic asthma
RG7185Phase IAsthma
AZD8075Terminated in Phase IAsthma/COPD[1]
UniProt IDQ9Y5Y4
FunctionOrphan receptor.    
SequenceMSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI MCYYNVLLLNPGPDRDATCNSRQAALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS//
Target ValidationClick to Find Target Validation Information.    
Inhibitor2- (2,4-diphenylthiazol-5-yl)acetic acid[2]
2- (2-acetyl-4-bromophenoxy)acetic acid[3]
2- (2-allyl-4-chlorophenoxy)acetic acid[4]
2- (2-benzhydryl-4-phenylthiazol-5-yl)acetic acid[5]
2- (2-benzoyl-4-bromophenoxy)acetic acid[3]
2- (2-cyclohexyl-4-fluorophenoxy)acetic acid[4]
2- (2-cyclohexyl-4-methoxyphenoxy)acetic acid[4]
2- (2-cyclohexyl-4-methylphenoxy)acetic acid[4]
2- (2-cyclohexylphenoxy)acetic acid[4]
2- (2-formylphenoxy)acetic acid[3]
2- (4-bromo-2-[3]
2- (4-bromo-2-cyclohexylphenoxy)acetic acid[4]
2- (4-bromo-2-formylphenoxy)acetic acid[3]
2- (4-bromo-2-tert-butylphenoxy)acetic acid[3]
2- (4-chloro-2-cycloheptylphenoxy)acetic acid[6]
2- (4-chloro-2-cyclohexylphenoxy)acetic acid[4]
2- (4-chloro-2-cyclopentylphenoxy)acetic acid[4]
2- (4-cyano-2-cyclohexylphenoxy)acetic acid[4]
3- (4-chloro-2-cyclohexylphenoxy)propanoic acid[4]
4- (4-chloro-2-cyclohexylphenoxy)butanoic acid[4]
L-888607[7]
LAROPIPRANT[8]
methyl 2- (4-chloro-2-cyclohexylphenoxy)acetate[4]
AntagonistAZD1981[1]
AZD5985[1]
AZD8075[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1AstraZeneca. Product Development Pipeline. January 29 2009. To Reference
Ref 2Bioorg Med Chem Lett. 2010 Feb 1;20(3):1177-80. Epub 2009 Dec 4.Novel selective thiazoleacetic acids as CRTH2 antagonists developed from in silico derived hits. Part 1. To Reference
Ref 3J Med Chem. 2006 Nov 16;49(23):6638-41.Novel selective orally active CRTH2 antagonists for allergic inflammation developed from in silico derived hits. To Reference
Ref 4Bioorg Med Chem Lett. 2007 Aug 1;17(15):4347-50. Epub 2007 May 13.2-Cycloalkyl phenoxyacetic acid CRTh2 receptor antagonists. To Reference
Ref 5Bioorg Med Chem Lett. 2010 Feb 1;20(3):1181-5. Epub 2009 Dec 6.Novel selective thiazoleacetic acids as CRTH2 antagonists developed from in silico derived hits. Part 2. To Reference
Ref 6Bioorg Med Chem Lett. 2009 Aug 15;19(16):4794-8. Epub 2009 Jun 14.7-Azaindole-3-acetic acid derivatives: potent and selective CRTh2 receptor antagonists. To Reference
Ref 7J Med Chem. 2005 Oct 6;48(20):6174-7.Indole-3-acetic acid antagonists of the prostaglandin D2 receptor CRTH2. To Reference
Ref 8J Med Chem. 2007 Feb 22;50(4):794-806.Discovery of a potent and selective prostaglandin D2 receptor antagonist, [(3R)-4-(4-chloro-benzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid (MK-0524). To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543