Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00243

Target Information
NameSolute carrier family 22 member 12    
Type of targetClinical trial target    
SynonymsOrganic anion transporter 4-like protein    
RST    
Renal-specific transporter    
Urate anion exchanger 1    
DiseaseGout
[ICD9: 274.00274.1274.8274.9   ICD10: M10]
[1]
Drug(s)LesinuradPhase IIIChronic management of hyperuricaemia
RDEA 594Phase IIGout[1]
RDEA3170Phase IChronic management of hyperuricaemia in patients with gout
UniProt IDQ96S37
FunctionRequired for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions.    
SequenceMAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQ ASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGW VYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSY LQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLG FSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELW RVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAF GFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCI LANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGA ILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATH GTLGNSVLKSTQF//
Target ValidationClick to Find Target Validation Information.    
InhibitorMORIN[2]
BlockerRDEA 594[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1New relief for gout. Nat Biotechnol. 2009 Apr;27(4):309-11. To Reference
Ref 2Drug Metab Dispos. 2007 Jun;35(6):981-6. Epub 2007 Feb 26.Morin (3,5,7,2',4'-pentahydroxyflavone) exhibits potent inhibitory actions on urate transport by the human urate anion transporter (hURAT1) expressed in human embryonic kidney cells. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543