Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDC00336

Target Information
NamemRNA of sodium-glucose transporter-2    
Type of targetClinical trial target    
SynonymsmRNA of Low affinity sodium-glucose cotransporter    
mRNA of Na(+)/glucose cotransporter 2    
mRNA of SGLT2    
mRNA of SLC5A2    
mRNA of Sodium/glucose cotransporter 2    
mRNA of Solute carrier family 5 member 2    
DiseaseType 2 Diabetes
[ICD9: 250.00, 250.02   ICD10: E11]
[1]
Drug(s)ISIS-SGLT2Phase IType 2 Diabetes[1]
UniProt IDP31639
FunctionSodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.    
SequenceMEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM MAVAVFLWGFYA
Target ValidationClick to Find Target Validation Information.    
Inhibitor10-methoxy-N (1)-methylburnamine-17-O-veratrate[2]
ACEROGENIN B[3]
Alstiphyllanine D[2]
Alstiphyllanine E[2]
Alstiphyllanine F[2]
Burnamine-17-O-3',4',5'-trimethoxybenzoate[2]
FORMONONETIN[4]
KURAIDIN[4]
KURARINONE[4]
MAACKIAIN[4]
O-spiroketal glucoside[5]
PHLORIZIN[6]
SERGLIFLOZIN A[7]
acerogenin C[3]
kushenol N[4]
remogliflozin[8]
sophoraflavanone G[4]
AntisenseISIS-SGLT2[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 12011 Pipeline of ISIS Pharm. To Reference
Ref 2Bioorg Med Chem. 2010 Mar 15;18(6):2152-8. Epub 2010 Feb 6.Alstiphyllanines E-H, picraline and ajmaline-type alkaloids from Alstonia macrophylla inhibiting sodium glucose cotransporter. To Reference
Ref 3Bioorg Med Chem Lett. 2010 Feb 1;20(3):1070-4. Epub 2009 Dec 11.Cyclic diarylheptanoids as Na+-glucose cotransporter (SGLT) inhibitors from Acer nikoense. To Reference
Ref 4Bioorg Med Chem. 2007 May 15;15(10):3445-9. Epub 2007 Mar 12.Na+-glucose cotransporter (SGLT) inhibitory flavonoids from the roots of Sophora flavescens. To Reference
Ref 5Bioorg Med Chem. 2010 Jun 15;18(12):4422-32. Epub 2010 Apr 29.ortho-Substituted C-aryl glucosides as highly potent and selective renal sodium-dependent glucose co-transporter 2 (SGLT2) inhibitors. To Reference
Ref 6J Med Chem. 2010 Apr 22;53(8):3247-61.(1S)-1,5-anhydro-1-[5-(4-ethoxybenzyl)-2-methoxy-4-methylphenyl]-1-thio-D-glucitol (TS-071) is a potent, selective sodium-dependent glucose cotransporter 2 (SGLT2) inhibitor for type 2 diabetes treatment. To Reference
Ref 7Bioorg Med Chem. 2010 Mar 15;18(6):2178-94. Epub 2010 Feb 4.Novel C-aryl glucoside SGLT2 inhibitors as potential antidiabetic agents: 1,3,4-Thiadiazolylmethylphenyl glucoside congeners. To Reference
Ref 8J Med Chem. 2009 Apr 9;52(7):1785-94.Development of the renal glucose reabsorption inhibitors: a new mechanism for the pharmacotherapy of diabetes mellitus type 2. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543