Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00033

Target Information
NameAldo-keto reductase family 1 member C3    
Type of targetResearch target    
Synonyms3-alpha-hydroxysteroid dehydrogenase    
3alpha-HSD    
AKR1C3    
Chlordecone reductase homolog HAKRb    
DD3    
Dihydrodiol dehydrogenase 3    
Dihydrodiol dehydrogenase, type I    
HA1753    
HPGFS    
Human prostaglandin F synthase    
Prostaglandin F synthase    
Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
Head and neck cancer
[ICD9: 140-149   ICD10: C07-C14, C32-C33]
[2]
BioChemical ClassOxidoreductases acting on the CH-OH group of donors    
EC NumberEC 1.1.1.-
EC 1.1.1.188
EC 1.3.1.20
PathwayArachidonic acid metabolism
Metabolism of xenobiotics by cytochrome P450
UniProt IDP42330
PDB Structure1RY0; 1RY8; 1S1P; 1S1R; 1S2A; 1S2C; 1XF0; 1ZQ5.    
FunctionCatalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (pg) d2, pgh2 and phenanthrenequinone (pq) and the oxidation of 9alpha,11beta- pgf2 to pgd2.    
SequenceMDSKQQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD RNLHYFNSDSFASHPNYPYSDEY
Target ValidationClick to Find Target Validation Information.    
Inhibitor2'-Monophosphoadenosine 5'-Diphosphoribose[3]
2,2-Dibenzylcyclopentanol[4]
2- (4-Chlorobenzylidene)cyclopentanone[4]
2- (4-chlorobenzylidene)cyclopentyl ethyl ether[4]
2- (4-chlorobenzylidene)cyclopentylmethyl ether[4]
2-Methyl-2,4-Pentanediol[3]
2-[ (2,2-diphenylacetyl)amino]benzoic acid[5]
3-Bromo-5-phenylsalicylc acid[6]
3-Phenylcyclopentanecarboxylic acid[4]
4-ANDROSTENE-3-17-DIONE[7]
Acetate Ion[3]
DICLOFENAC SODIUM[5]
EM-1424[8]
EM1396[8]
Flufenamic Acid[9]
M-Phenoxybenzoic Acid For Cis-Isomer[5]
Rutin[3]
Agonist4-Androstenedione[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin. Cancer Res. 2004 Mar 1;64(5):1802-10. To Reference
Ref 2Preferential expression of hPGFS in primary SCCHN and tumour cell lines derived from respiratory and digestive organs. Br J Cancer. 2004 Mar 8;90(5):1093-9. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 4Eur J Med Chem. 2009 Jun;44(6):2563-71. Epub 2009 Feb 5.New cyclopentane derivatives as inhibitors of steroid metabolizing enzymes AKR1C1 and AKR1C3. To Reference
Ref 5Bioorg Med Chem Lett. 2005 Dec 1;15(23):5170-5. Epub 2005 Sep 23.Nonsteroidal anti-inflammatory drugs and their analogues as inhibitors of aldo-keto reductase AKR1C3: new lead compounds for the development of anticancer agents. To Reference
Ref 6J Med Chem. 2009 May 28;52(10):3259-64.Structure-guided design, synthesis, and evaluation of salicylic acid-based inhibitors targeting a selectivity pocket in the active site of human 20alpha-hydroxysteroid dehydrogenase (AKR1C1). To Reference
Ref 7Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 8J Biol Chem. 2007 Mar 16;282(11):8368-79. Epub 2006 Dec 13.Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase. To Reference
Ref 9Ouellet M, Percival MD: Effect of inhibitor time-dependency on selectivity towards cyclooxygenase isoforms. Biochem J. 1995 Feb 15;306 ( Pt 1):247-51. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543