|
|
TTD
Target ID:
TTDR00042
Target
Information |
Name | Beta-hydroxyacyl-acp dehydratase | Type of target | Research target | Synonyms | FabZ | Disease | Malaria [ICD9: 084 ICD10: B50-B54] | [1] | BioChemical Class | Carbon-oxygen lyases | EC Number | EC 4.2.1.- | Pathway | Fatty acid biosynthesis | Metabolic pathways | UniProt ID | Q8I6T4 | Sequence | MRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDV
SSQINQDNINGQNISFNLTFPNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGL
KQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWK
KPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK
| Target Validation | Click to Find Target Validation Information. | Inhibitor | (-)-CATECHINGALLATE |  | [2] | 2-Hexadecynoic acid |  | [3] | BIOCHANIN |  | [2] | EPICATECHIN GALLATE |  | [2] | EPIGALOCATECHIN GALLATE |  | [2] | FISETIN |  | [2] | GALLOCATECHIN GALLATE |  | [2] | MORIN |  | [2] |
Cross References |
3D Structure
Related Literature
On-Line
Medical Dictionary |
Ref 1 | Identification, characterization, and inhibition of Plasmodium falciparum beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ). J Biol Chem. 2003 Nov 14;278(46):45661-71. Epub 2003 Aug 20. To Reference | Ref 2 | J Med Chem. 2006 Jun 1;49(11):3345-53.Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. To Reference | Ref 3 | Bioorg Med Chem. 2010 Nov 1;18(21):7475-85. Epub 2010 Sep 18.2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. To Reference |
Welcome
to sign our Guestbook.
If you
find any error in data or bug in web service, please kindly report it
to Dr.
Zhu.
Dr.
Chen Yuzong
Deputy Director of Center
for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore
All rights reserved.
|