Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00042

Target Information
NameBeta-hydroxyacyl-acp dehydratase    
Type of targetResearch target    
SynonymsFabZ    
DiseaseMalaria
[ICD9: 084   ICD10: B50-B54]
[1]
BioChemical ClassCarbon-oxygen lyases    
EC NumberEC 4.2.1.-
PathwayFatty acid biosynthesis
Metabolic pathways
UniProt IDQ8I6T4
SequenceMRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDV SSQINQDNINGQNISFNLTFPNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGL KQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWK KPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK
Target ValidationClick to Find Target Validation Information.    
Inhibitor (-)-CATECHINGALLATE[2]
2-Hexadecynoic acid[3]
BIOCHANIN[2]
EPICATECHIN GALLATE[2]
EPIGALOCATECHIN GALLATE[2]
FISETIN[2]
GALLOCATECHIN GALLATE[2]
MORIN[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Identification, characterization, and inhibition of Plasmodium falciparum beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ). J Biol Chem. 2003 Nov 14;278(46):45661-71. Epub 2003 Aug 20. To Reference
Ref 2J Med Chem. 2006 Jun 1;49(11):3345-53.Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. To Reference
Ref 3Bioorg Med Chem. 2010 Nov 1;18(21):7475-85. Epub 2010 Sep 18.2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543