Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00115

Target Information
NameGTP cyclohydrolase I    
Type of targetResearch target    
SynonymsGTP-CH-I    
Guanosine triphosphate cyclohydrolase I    
DiseaseLesch-Nyhan syndrome[1]
Malaria
[ICD9: 084   ICD10: B50-B54]
[2]
Parkinson's disease
[ICD9: 332   ICD10: F02.3, G20]
[1]
BioChemical ClassHydrolases acting on carbon-nitrogen bonds    
EC NumberEC 3.5.4.16
PathwayFolate biosynthesis
Metabolic pathways
UniProt IDO97071
P30793
PDB Structure1FB1.    
FunctionIsoform gch-1 is the functional enzyme, the potential function of the enzymatically inactive isoforms remains unknown.    
SequenceMYKYTSINKSDKIYETHNMEEKKKKGNNNNFSGLLNNEIDDNNKKEKLKNSISKMYSNHK NRENFNECEKEDLVVIDEKDNNKKKKKNMTNTFEQDNNYNMNDNKRLGSFFKINDKCESI NENVNNINKQSLKDSILFDNINEKEYFNETKEENKEGNKSNDIEKINCMKVKKKTVKKNK KKINKIINNKNKISKSNDIEEQIINISKHIYKILNISKLPKCDILKRTNRRYAETFLYLT NGYNLDIEQIIKRSLYKRMYKNNSIIKVTGIHIYSLCKHHLLPFEGTCDIEYIPNKYIIG LSKFSRIVDVFSRRLQLQEDLTNDICNALKKYLKPLYIKVSIVAKHLCINMRGVKEHDAK TITYASYKAEKENPTVHSLNIDSSVENLN
Inhibitor8-hydroxyguanine[1]
ATP[2]
BH4[1]
Guanine[1]
Guanine[3]
Guanosine-5'-Triphosphate[3]
Isopropyl Alcohol[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1GTP cyclohydrolase I feedback regulatory protein-dependent and -independent inhibitors of GTP cyclohydrolase I. Arch Biochem Biophys. 2001 Apr 1;388(1):67-73. To Reference
Ref 2Guanosine triphosphate cyclohydrolase in Plasmodium falciparum and other Plasmodium species. Mol Biochem Parasitol. 1985 Dec;17(3):265-76. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 4Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543