Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00133

Target Information
NameL-lactate dehydrogenase    
Type of targetResearch target    
SynonymsLDH    
LDH1    
Lactate dehydrogenase    
DiseaseMalaria
[ICD9: 084   ICD10: B50-B54]
[1][2][3]
Toxoplasmic encephalitis
[ICD9: 323   ICD10: A83-A86, B94.1, G05]
[4]
BioChemical ClassOxidoreductases acting on the CH-OH group of donors    
EC NumberEC 1.1.1.27
PathwayCysteine metabolism
Glycolysis / Gluconeogenesis
Propanoate metabolism
Pyruvate metabolism
UniProt IDP13774
Q07251
SequenceMKISLTSARQLARDILAAQQVPADIADDVAEHLVESDRCGYISHGLSILPNYRTALDGHS VNPQGRAKCVLDQGTLMVFDGDGGFGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRM GHYGEMAAAAGFVLLSFTNVINRAPVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIA TSAIAINKARVLAEKGEPAPEGSIIGADGNPTTDASTMFGEHPGALLPFGGHKGYALGVV AELLAGVLSGGGTIQPDNPRGGVATNNLFAVLLNPALDLGLDWQSAEVEAFVRYLHDTPP APGVDRVQYPGEYEAANRAQASDTLNINPAIWRNLERLAQSLNVAVPTA
Inhibitor3,7-DIHYDROXYNAPHTHALENE-2-CARBOXYLIC ACID[5]
3-Hydroxyisoxazole-4-Carboxylic Acid[6]
4-Hydroxy-1,2,5-Oxadiazole-3-Carboxylic Acid[6]
4-Hydroxy-1,2,5-Thiadiazole-3-Carboxylic Acid[6]
Naphthalene-2,6-disulfonic acid[7]
Nicotinamide-Adenine-Dinucleotide[6]
Oxalate Ion[6]
Oxamic Acid[6]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Following the course of malaria treatment by detecting parasite lactate dehydrogenase enzyme. Br J Haematol. 2001 May;113(2):558-9. To Reference
Ref 2Crystal structure of Plasmodium berghei lactate dehydrogenase indicates the unique structural differences of these enzymes are shared across the Plasmodium genus. Mol Biochem Parasitol. 2003 Sep;131(1):1-10. To Reference
Ref 3Substrate and cofactor specificity and selective inhibition of lactate dehydrogenase from the malarial parasite P. falciparum. Mol Biochem Parasitol. 1997 Dec 1;90(1):235-46. To Reference
Ref 4Structure of Toxoplasma gondii LDH1: active-site differences from human lactate dehydrogenases and the structural basis for efficient APAD+ use. Biochemistry. 2004 Feb 3;43(4):879-89. To Reference
Ref 5Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 6Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 7Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543