Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00184

Target Information
NameGalanin receptor type 1    
Type of targetResearch target    
SynonymsGAL1-R    
GALR1    
DiseaseConvulsions
[ICD9: 780.3   ICD10: R56.0]
[1]
Obesity
[ICD9: 278   ICD10: E66]
[2]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDP47211
FunctionReceptor for the hormone galanin. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.    
SequenceMELAVGNLSEGNASCPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKENKSRIDTPPSTNCTHV
Related US Patent6,407,136
Target ValidationClick to Find Target Validation Information.    
Inhibitor (Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKK[3]
(Sar)WTLNSAGYLLGPKKKK[3]
GALANIN[4]
GALANTIDE[5]
GWTLNSAGYLLGPHAV-NH2[6]
GWTLNSAGYLLGPPPALALA-CONH2[5]
GWTLNSAGYLLGPPPGFSPFR-CONH2[5]
GWTLNSAGYLLGPRHYINLITRQRY-CONH2[5]
GWTLNSAGYLLGPrPKPQQwFwLL-CONH2[5]
Gal-B5[5]
GalB2[5]
GwTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2[5]
WTLNSAGYLL-CONH2[5]
WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2[5]
[N-Ac,des-Sar]Gal-B2[5]
[N-Me,des-Sar]Gal-B2[5]
[Sar1Ala]GAL-B2[5]
[Sar1Gly]GAL-B2[5]
AgonistGalnon[1]
NAX-5055[7]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Anticonvulsant activity of a nonpeptide galanin receptor agonist. Proc Natl Acad Sci U S A. 2002 May 14;99(10):7136-41. To Reference
Ref 2Galanin/GALP and galanin receptors: role in central control of feeding, body weight/obesity and reproduction? Eur J Pharmacol. 2002 Apr 12;440(2-3):255-68. To Reference
Ref 3J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. To Reference
Ref 4J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. To Reference
Ref 5J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. To Reference
Ref 6J Med Chem. 2008 Dec 25;51(24):8038-47.Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities. To Reference
Ref 7Epilepsy Res. 2009 Jan;83(1):1-43. Epub 2008 Nov 12.Progress report on new antiepileptic drugs: a summary of the Ninth Eilat Conference (EILAT IX). To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543