Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00201

Target Information
NameGamma-aminobutyric acid transporter 4    
Type of targetResearch target    
SynonymsGABA transporter 4    
GAT4    
Sodium- and chloride-dependent GABA transporter 4    
DiseaseConvulsions
[ICD9: 780.3   ICD10: R56.0]
[1]
BioChemical ClassTransmembrane protein    
UniProt IDP31650
FunctionTerminates the action of gaba by its high affinity sodium-dependent reuptake into presynaptic terminals. Has a km of 0.8 mum for gaba; can also transport beta-alanine (km=99 mum) and taurine (km=1.4 mum).    
SequenceMTAEQALPLGNGKAAEEARGSETLGGGGGGAAGTREARDKAVHERGHWNNKVEFVLSVAG EIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRRV CPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTEKCVEFQK LNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAGWTICYFCIWK GTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQ IFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGV PIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDM YPKVFRRGYRRELLILALSIISYFLGLVMLTEGGMYIFQLFGSYAASGMCLLFVAIFECV CIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNVYT YPAWGYGIGWLMALSSMLCIPLWIFIKLWKTEGTLPEKLQKLTVPSADLKMRGKLGASPR TVTVNDCEAKVKGDGTISAITEKETHF
BlockerSNAP-5114[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1GABA-level increasing and anticonvulsant effects of three different GABA uptake inhibitors. Neuropharmacology. 2000 Sep;39(12):2399-407. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543