Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00209

Target Information
NameCarbonic anhydrase IV    
Type of targetResearch target    
SynonymsCA-IV    
Carbonate dehydratase IV    
DiseaseGlaucoma
[ICD9: 365   ICD10: H40-H42]
[1]
Pancreatic cancer
[ICD9: 157   ICD10: C25]
[2]
Renal failure
[ICD9: 584, 585   ICD10: N17, N18, N19]
[3]
Salivary glands cancer
[ICD9: 140-229   ICD10: C00-C96]
[2]
BioChemical ClassCarbon-oxygen lyases    
EC NumberEC 4.2.1.1
PathwayNitrogen metabolism
UniProt IDP22748
PDB Structure1ZNC.    
FunctionReversible hydration of carbon dioxide.    
SequenceMRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG PMLACLLAGFLR
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor1- (3,4-dichlorophenyl)-3-hydroxyurea[4]
2,4-Disulfamyltrifluoromethylaniline[5]
2-Propyl-pentanoic acid 4-sulfamoyl-benzyl ester[6]
2-Propyl-pentanoic acid 4-sulfamoyl-benzylamide[6]
2-oxo-2H-chromene-3-carboxylic acid[7]
3-Amino-benzenesulfonamide[5]
4- (2-Amino-ethyl)-benzenesulfonamide[5]
4-Amino-3-bromo-benzenesulfonamide[5]
4-Amino-3-chloro-benzenesulfonamide[5]
4-Amino-3-fluoro-benzenesulfonamide[5]
4-Amino-3-iodo-benzenesulfonamide[5]
4-Hydrazino-benzenesulfonamide[5]
5-amino-1,3,4-thiadiazole-2-sulfonamide[8]
6- (aminomethyl)-2H-chromen-2-one[7]
6- (hydroxymethyl)-2H-chromen-2-one[7]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid[7]
7- (benzyloxy)-2H-chromen-2-one[7]
BENZOLAMIDE[9]
CATECHIN[10]
CATECHOL[11]
COUMARIN[7]
COUMATE[12]
CURCUMIN[10]
Carbamoyl phosphate,   di sodium[13]
Ditiocarb sodium[14]
ELLAGIC ACID[11]
FERULIC ACID[11]
GALLICACID[11]
HERNIARIN[7]
MAFENIDE[5]
N- (5-Sulfamoyl-[1,3,4]thiadiazol-2-yl)-benzamide[6]
N- (5-ethyl-1,3,4-thiadiazol-2-yl)sulfamide[15]
N- (5-phenyl-1,3,4-thiadiazol-2-yl)sulfamide[15]
N- (5-tert-butyl-1,3,4-thiadiazol-2-yl)sulfamide[15]
N-1,3,4-thiadiazol-2-ylsulfamide[15]
N-[5- (ethylthio)-1,3,4-thiadiazol-2-yl]sulfamide[15]
N-[5- (methylthio)-1,3,4-thiadiazol-2-yl]sulfamide[15]
N-hydroxysulfonamides[16]
N1- (naphthalen-1-yl)ethane-1,2-diamine[17]
PARABEN[11]
PHENOL[10]
PYRUVATE SODIUM[18]
Phenyl-phosphonic acid[19]
Phenylarsonic acid[20]
SALICYLATE[21]
SODIUM CITRATE[18]
SODIUM PHOSPHATE, DIBASIC, ANHYDROUS[13]
SPARFOSIC ACID[19]
SPERMINE[17]
SULFAMATE[20]
SULFAMIDE[22]
Sodium,   Malonate[18]
Sodium,   Oxalate[18]
Sulfenamido-sulfonamides[23]
Syringic Acid[11]
[Cu (CN)2]-[24]
[Fe (CN)6]4-[24]
aminocarbonyl dihydrogen phosphate[19]
decane-1,10-diyl disulfamate[25]
decyl sulfamate[25]
ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate[7]
hexane-1,6-diamine[17]
octane-1,8-diyl disulfamate[25]
octyl sulfamate[25]
p-Coumaric Acid[11]
pentane-1,5-diamine[17]
phenylboronic acid[26]
sodium phenylarsonate[26]
sodium sulfamate[26]
sodium trithiocarbonate[14]
trisodium phosphate[13]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Carbonic anhydrase inhibitors: synthesis and inhibition against isozymes I, II and IV of topically acting antiglaucoma sulfonamides incorporating cis-5-norbornene-endo-3-carboxy-2-carboxamido moieties. J Enzyme Inhib. 2001;16(2):113-23. To Reference
Ref 2Identification of carbonic anhydrase IV and VI mRNA expression in human pancreas and salivary glands. Pancreas. 1999 May;18(4):329-35. To Reference
Ref 3Physiology and molecular biology of renal carbonic anhydrase. J Nephrol. 2002 Mar-Apr;15 Suppl 5:S61-74. To Reference
Ref 4Bioorg Med Chem Lett. 2006 Aug 15;16(16):4316-20. Epub 2006 Jun 12.N-hydroxyurea--a versatile zinc binding function in the design of metalloenzyme inhibitors. To Reference
Ref 5Bioorg Med Chem Lett. 2005 Feb 15;15(4):1149-54.Carbonic anhydrase inhibitors. Inhibition of the membrane-bound human and bovine isozymes IV with sulfonamides. To Reference
Ref 6J Med Chem. 2002 Jan 17;45(2):312-20.Carbonic anhydrase inhibitors: anticonvulsant sulfonamides incorporating valproyl and other lipophilic moieties. To Reference
Ref 7J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. To Reference
Ref 8Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamide resides in a less utilized binding pocket than most hydrophobic inhibitors. To Reference
Ref 9Bioorg Med Chem Lett. 2003 Sep 1;13(17):2867-73.Carbonic anhydrase inhibitors: topically acting antiglaucoma sulfonamides incorporating esters and amides of 3- and 4-carboxybenzolamide. To Reference
Ref 10Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. To Reference
Ref 11Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. To Reference
Ref 12Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. To Reference
Ref 13Bioorg Med Chem Lett. 2004 Dec 6;14(23):5763-7.Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with phosphates, carbamoyl phosphate, and the phosphonate antiviral drug foscarnet. To Reference
Ref 14Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7. Epub 2009 Feb 26.Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. To Reference
Ref 15Bioorg Med Chem Lett. 2008 Dec 15;18(24):6332-5. Epub 2008 Nov 1.Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes VA and VB over the cytosolic and membrane-associated carbonic anhydrases I, II and IV. To Reference
Ref 16Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84. To Reference
Ref 17J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. To Reference
Ref 18Bioorg Med Chem Lett. 2005 Feb 1;15(3):573-8.Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with carboxylates. To Reference
Ref 19Bioorg Med Chem Lett. 2005 Mar 15;15(6):1683-6.Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with organic phosphates and phosphonates. To Reference
Ref 20Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. To Reference
Ref 21Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. To Reference
Ref 22Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. To Reference
Ref 23Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90. To Reference
Ref 24Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13.Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides. To Reference
Ref 25J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. To Reference
Ref 26Bioorg Med Chem Lett. 2009 Feb 15;19(4):1155-8. Epub 2008 Dec 25.Carbonic anhydrase inhibitors: the membrane-associated isoform XV is highly inhibited by inorganic anions. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543