Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00210

Target Information
NameCarbonic anhydrase VI    
Type of targetResearch target    
SynonymsCA-VI    
Carbonate dehydratase VI    
Salivary carbonic anhydrase    
Secreted carbonic anhydrase    
DiseasePancreatic cancer
[ICD9: 157   ICD10: C25]
[1]
Salivary glands cancer
[ICD9: 140-229   ICD10: C00-C96]
[1]
BioChemical ClassCarbon-oxygen lyases    
EC NumberEC 4.2.1.1
PathwayNitrogen metabolism
UniProt IDP23280
PDB Structure3FE4.    
FunctionReversible hydration of carbon dioxide. Its role in saliva is unknown.    
SequenceMRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL DYLRRALN
Target ValidationClick to Find Target Validation Information.    
Inhibitor2,4-Disulfamyltrifluoromethylaniline[2]
2-aminobenzenesulfonamide[2]
2-hydrazinylbenzenesulfonamide[2]
4- (2-aminopyrimidin-4-ylamino)benzenesulfonamide[2]
4- (2-hydroxyethyl)benzenesulfonamide[2]
4- (hydroxymethyl)benzenesulfonamide[2]
4-CYANOPHENOL[3]
4-amino-3-bromobenzenesulfonamide[2]
4-amino-3-chlorobenzenesulfonamide[2]
4-amino-3-fluorobenzenesulfonamide[2]
4-amino-3-iodobenzenesulfonamide[2]
4-amino-6-chlorobenzene-1,3-disulfonamide[2]
4-amino-N- (4-sulfamoylbenzyl)benzenesulfonamide[2]
4-hydrazinylbenzenesulfonamide[2]
5-amino-1,3,4-thiadiazole-2-sulfonamide[4]
6- (aminomethyl)-2H-chromen-2-one[5]
6- (hydroxymethyl)-2H-chromen-2-one[5]
6-hydroxybenzo[d]thiazole-2-sulfonamide[2]
7-butoxy-2H-chromen-2-one[5]
7-propoxy-2H-chromen-2-one[5]
BENZOLAMIDE[2]
CATECHIN[6]
COUMARIN[5]
COUMATE[7]
CURCUMIN[6]
Carzenide,   Para-Carboxybenzenesulfonamide (Weak Carbonic Anhydrase Inhibitor)[2]
ELLAGIC ACID[8]
FERULIC ACID[8]
GALLICACID[8]
HERNIARIN[5]
INDISULAM[2]
MAFENIDE[2]
N1- (2-aminoethyl)ethane-1,2-diamine[9]
N1- (naphthalen-1-yl)ethane-1,2-diamine[9]
P-TOLUENESULFONAMIDE[2]
PARABEN[8]
SALICYLATE[3]
SPERMINE[9]
Syringic Acid[8]
decane-1,10-diyl disulfamate[10]
decyl sulfamate[10]
ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate[5]
hexane-1,6-diamine[9]
octane-1,8-diyl disulfamate[10]
octyl sulfamate[10]
p-Coumaric Acid[8]
pentane-1,5-diamine[9]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1The human insulin gene contains multiple transcriptional elements that respond to glucocorticoids. Pancreas. 1999 May;18(4):336-41. To Reference
Ref 2J Med Chem. 2009 Feb 12;52(3):646-54.Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. To Reference
Ref 3Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. To Reference
Ref 4Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamide resides in a less utilized binding pocket than most hydrophobic inhibitors. To Reference
Ref 5J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. To Reference
Ref 6Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. To Reference
Ref 7Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. To Reference
Ref 8Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. To Reference
Ref 9J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. To Reference
Ref 10J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543