Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00213

Target Information
NameCarbonic anhydrase XIV    
Type of targetResearch target    
SynonymsCA-XIV    
Carbonate dehydratase XIV    
UNQ690/PRO1335    
DiseaseRenal failure
[ICD9: 584, 585   ICD10: N17, N18, N19]
[1]
BioChemical ClassCarbon-oxygen lyases    
EC NumberEC 4.2.1.1
PathwayNitrogen metabolism
UniProt IDQ9ULX7
FunctionReversible hydration of carbon dioxide.    
SequenceMLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Target ValidationClick to Find Target Validation Information.    
Inhibitor2,3-dihydro-1H-indene-5-sulfonamide[2]
2,4-Disulfamyltrifluoromethylaniline[3]
2-Amino-benzenesulfonamide[3]
2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid[2]
2-amino-2,3-dihydro-1H-indene-5-sulfonamide[2]
2-amino-2,3-dihydro-1H-indene-5-sulfonic acid[2]
2-oxo-2H-chromene-3-carboxylic acid[4]
2-oxo-2H-thiochromene-3-carboxylic acid[4]
3-Amino-benzenesulfonamide[3]
4,4'-thiodipyridine-3-sulfonamide[5]
4- (2-Amino-ethyl)-benzenesulfonamide[3]
4- (2-Hydroxy-ethyl)-benzenesulfonamide[3]
4- (2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide[5]
4- (2-Propynylthio)pyridine-3-sulfonamide[5]
4- (5-Methyl-2-pirazolino)-3-pyridinesulfonamide[5]
4- (Allylamino)-3-pyridinesulfonamide[5]
4- (Carbamolymethylthio)pyridine-3-sulfonamide[5]
4- (Cyanomethylthio)pyridine-3-sulfonamide[5]
4- (Methylhydrazino)-3-pyridinesulfonamide[5]
4- (Quinolinoxy)-3-pyridinesulfonamide[5]
4-AMINOPHENOL[6]
4-Amino-3-bromo-benzenesulfonamide[3]
4-Amino-3-chloro-benzenesulfonamide[3]
4-Amino-3-fluoro-benzenesulfonamide[3]
4-Amino-3-iodo-benzenesulfonamide[3]
4-Benzythiopyridine-3-sulfonamide[5]
4-Ethoxy-3-pyridinesulfonamide[5]
4-Hydrazino-3-pyridinesulfonamide[5]
4-Hydrazino-benzenesulfonamide[3]
4-Hydroxymethyl-benzenesulfonamide[3]
4-Methylthiopyridine-3-sulfonamide[5]
5-amino-1,3,4-thiadiazole-2-sulfonamide[7]
6- (aminomethyl)-2H-chromen-2-one[4]
6- (hydroxymethyl)-2H-chromen-2-one[4]
6-Hydroxy-benzothiazole-2-sulfonic acid amide[3]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid[4]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid[4]
7- (benzyloxy)-2H-chromen-2-one[4]
7-butoxy-2H-chromen-2-one[4]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid[4]
7-phenethoxy-2H-chromen-2-one[4]
7-propoxy-2H-chromen-2-one[4]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid[4]
BENZOLAMIDE[3]
Beta-D-Mannose[8]
CATECHIN[9]
COUMARIN[4]
COUMATE[10]
CURCUMIN[9]
Carzenide,   Para-Carboxybenzenesulfonamide (Weak Carbonic Anhydrase Inhibitor)[3]
ELLAGIC ACID[11]
ETHOXYCOUMARIN[4]
FERULIC ACID[11]
GALLICACID[11]
HERNIARIN[4]
INDISULAM[5]
MAFENIDE[3]
N-propynyl amidebenzenesulphonide[12]
N1- (2-aminoethyl)ethane-1,2-diamine[13]
N1- (naphthalen-1-yl)ethane-1,2-diamine[13]
O-propynylamide benzenesulphonamide[12]
PARABEN[11]
PHENOL[9]
RESORCINOL[6]
SPERMINE[13]
Syringic Acid[11]
TRIENTINE[13]
decane-1,10-diyl disulfamate[14]
decyl sulfamate[14]
ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate[4]
hexane-1,6-diamine[13]
octane-1,8-diyl disulfamate[14]
octyl sulfamate[14]
p-Coumaric Acid[11]
pentane-1,5-diamine[13]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Carbonic anhydrase XIV: luminal expression suggests key role in renal acidification. Kidney Int. 2002 Jun;61(6):2111-8. To Reference
Ref 2Eur J Med Chem. 2008 Dec;43(12):2853-60. Epub 2008 Feb 29.Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation. To Reference
Ref 3Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. To Reference
Ref 4J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. To Reference
Ref 5Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides. To Reference
Ref 6Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. To Reference
Ref 7Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamide resides in a less utilized binding pocket than most hydrophobic inhibitors. To Reference
Ref 8Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 9Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. To Reference
Ref 10Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. To Reference
Ref 11Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. To Reference
Ref 12Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92. Epub 2006 Nov 17.Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides. To Reference
Ref 13J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. To Reference
Ref 14J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543