Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00242

Target Information
NameCytochrome P450 1B1    
Type of targetResearch target    
SynonymsCYP1B1    
CYPIB1    
DiseaseBreast cancer
[ICD9: 174, 175   ICD10: C50]
[1]
Colon adenocarcinoma
[ICD9: 140-199   ICD10: C00-C75, C7A, C7B]
[2]
Prostate cancer
[ICD9: 185   ICD10: C61]
[3]
BioChemical ClassOxidoreductases acting on paired donors    
EC NumberEC 1.14.14.1
PathwayMetabolism of xenobiotics by cytochrome P450
Tryptophan metabolism
UniProt IDQ16678
FunctionCytochromes p450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an nadph-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids and fatty acids.    
SequenceMGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE TCQ
Target ValidationClick to Find Target Validation Information.    
Inhibitor2-[2- (3,5-Dimethoxy-phenyl)-vinyl]-thiophene[4]
3-[2- (3,5-Dimethoxy-phenyl)-vinyl]-furan[4]
4-[2- (3,5-Dimethoxy-phenyl)-vinyl]-pyridine[4]
ACACETIN[5]
APIGENIN[5]
CHRYSIN[5]
CHRYSOERIOL[5]
DIOSMETIN[5]
ERIODICTYOL[5]
GALANGIN[5]
HOMOERIODICTYOL[5]
ISORHAMNETIN[5]
ISOSAKUTANETIN[5]
KAEMPFERIDE[5]
KAEMPFEROL[5]
N- (2,4-Dimethoxy-phenyl)-3,5-dimethoxy-benzamide[4]
NARINGENIN[5]
PINOCEMBRIN[5]
TAMARIXETIN[5]
TRISMETHOXYRESVERATROL[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Cytochrome P450 CYP1B1 and catechol O-methyltransferase (COMT) genetic polymorphisms and breast cancer susceptibility in a Turkish population. Arch Toxicol. 2002 Nov;76(11):643-9. Epub 2002 Aug 21. To Reference
Ref 2Cytochrome P450 1B1 (CYP1B1) is overexpressed in human colon adenocarcinomas relative to normal colon: implications for drug development. Mol Cancer Ther. 2003 Jun;2(6):527-34. To Reference
Ref 3Polymorphisms of the CYP1B1 gene have higher risk for prostate cancer. Biochem Biophys Res Commun. 2002 Aug 30;296(4):820-6. To Reference
Ref 4J Med Chem. 2002 Jan 3;45(1):160-4.Design, synthesis, and discovery of novel trans-stilbene analogues as potent and selective human cytochrome P450 1B1 inhibitors. To Reference
Ref 5Bioorg Med Chem. 2010 Sep 1;18(17):6310-5. Epub 2010 Jul 13.Selective inhibition of methoxyflavonoids on human CYP1B1 activity. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543