Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00257

Target Information
NameCasein kinase II, alpha chain    
Type of targetClinical trial target    
SynonymsCK II    
Protein kinase CK2    
DiseaseBreast cancer
[ICD9: 174, 175   ICD10: C50]
[1]
Cancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[2]
EC NumberEC 2.7.1.37
UniProt IDP19138
PDB Structure1JWH; 1NA7; 1PJK; 2PVR; 2ZJW; 3BQC; 3BW5; 3C13.    
FunctionCasein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. Participates in wnt signaling.    
SequenceMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Target ValidationClick to Find Target Validation Information.    
Inhibitor4,5,6,7-tetrabromo-1H-benzimidazole[3]
4,5,6,7-tetrabromo-1H-benzo[d][1,2,3]triazole[4]
4-[ (3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol[5]
5,6,8-trichloroquinoline-4-one-3-carboxylic acid[6]
5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole[4]
7,8-dichloroquinoline-4-one-3-carboxylic acid[6]
APIGENIN[4]
AdoC (Dpr)2AlaArg6[7]
BALANOL[8]
CGP-029482[4]
ELLAGIC ACID[4]
EMODIN[4]
Resveratrol[9]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Roles of IKK kinases and protein kinase CK2 in activation of nuclear factor-kappaB in breast cancer. Cancer Res. 2001 May 1;61(9):3810-8. To Reference
Ref 2Protein kinase CK2 as regulator of cell survival: implications for cancer therapy. Curr Cancer Drug Targets. 2004 Feb;4(1):77-84. To Reference
Ref 3Bioorg Med Chem. 2009 Feb 15;17(4):1573-8. Epub 2009 Jan 7.Synthesis of new analogs of benzotriazole, benzimidazole and phthalimide--potential inhibitors of human protein kinase CK2. To Reference
Ref 4Bioorg Med Chem Lett. 2009 Jun 1;19(11):2920-3. Epub 2009 Apr 22.Structural insight into human CK2alpha in complex with the potent inhibitor ellagic acid. To Reference
Ref 5J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. To Reference
Ref 6J Med Chem. 2006 Nov 2;49(22):6443-50.Evaluation of 3-carboxy-4(1H)-quinolones as inhibitors of human protein kinase CK2. To Reference
Ref 7Bioorg Med Chem Lett. 1999 May 17;9(10):1447-52.Adenosine-5'-carboxylic acid peptidyl derivatives as inhibitors of protein kinases. To Reference
Ref 8J Med Chem. 1996 Dec 20;39(26):5215-27.Synthesis and protein kinase C inhibitory activities of acyclic balanol analogs that are highly selective for protein kinase C over protein kinase A. To Reference
Ref 9Inhibition of protein kinase CKII activity by resveratrol, a natural compound in red wine and grapes. Life Sci. 2002 Sep 20;71(18):2145-52. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543