Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00292

Target Information
Name3-oxoacyl-[acyl-carrier-protein] synthase II    
Type of targetResearch target    
Synonyms3-oxoacyl-[acyl-carrier-protein] synthase 2    
Beta-ketoacyl-ACP synthase 2    
Beta-ketoacyl-ACP synthase II    
Beta-ketoacyl-acyl carrier protein synthase B    
Condensing enzyme FabF    
FabF    
KAS 2    
KAS II    
KASB    
DiseaseBacterial infections
[ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104   ICD10: A00-A09, A15-A19, A20-A28, A30-A49, A65-A69, A70-A74, A75-A79]
[1][2][3]
Tuberculosis
[ICD9: 010-018   ICD10: A15-A19]
[2]
EC NumberEC 2.3.1.41
UniProt IDP39435
Q10525
PDB Structure1B3N; 1KAS; 2GFV; 2GFW; 2GFX; 2GFY; 3G0Y; 2GP6.    
FunctionCatalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-acp. Has a preference for short chain acid substrates and may function to supply the octanoic substrates for lipoic acid biosynthese.    
SequenceMSKRRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCE DIISRKEQRKMDAFIQYGIVAGVQAMQDSGLEITEENATRIGAAIGSGIGGLGLIEENHT SLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAY GDADVMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLV LEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGY VNAHGTSTPAGDKAEAQAVKTIFGEAASRVLVSSTKSMTGHLLGAAGAVESIYSILALRD QAVPPTINLDNPDEGCDLDFVPHEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
InhibitorLauric Acid[4]
PLATENSIMYCIN[5]
Platensimycin[6]
BinderThiolactomycin
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Lipid biosynthesis as a target for antibacterial agents. Prog Lipid Res. 2001 Nov;40(6):467-97. To Reference
Ref 2Requirement for kasB in Mycobacterium mycolic acid biosynthesis, cell wall impermeability and intracellular survival: implications for therapy. Mol Microbiol. 2003 Sep;49(6):1547-63. To Reference
Ref 3The 1.3-Angstrom-resolution crystal structure of beta-ketoacyl-acyl carrier protein synthase II from Streptococcus pneumoniae. J Bacteriol. 2003 Jul;185(14):4136-43. To Reference
Ref 4Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 5Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 6Platensimycin is a selective FabF inhibitor with potent antibiotic properties. Nature. 2006 May 18;441(7091):358-61. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543