Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00352

Target Information
NameMitogen-activated protein kinase 11    
Type of targetResearch target    
SynonymsMAP kinase p38 beta    
Mitogen-activated protein kinase p38 beta    
P38 Mitogen-activated protein kinase beta    
P38-2    
P38b    
Stress-activated protein kinase-2    
DiseaseInflammation[1]
Psoriasis
[ICD9: 696   ICD10: L40]
[1]
Rheumatoid arthritis, unspecified
[ICD9: 710-719, 714   ICD10: M00-M25, M05-M06]
[1]
BioChemical ClassTransferases transferring phosphorus-containing groups    
EC NumberEC 2.7.1.37
PathwayAmyotrophic lateral sclerosis (ALS)
Epithelial cell signaling in Helicobacter pylori
Fc epsilon RI signaling pathway
GnRH signaling pathway
Leukocyte transendothelial migration
MAPK signaling pathway
T cell receptor signaling pathway
Toll-like receptor signaling pathway
VEGF signaling pathway
UniProt IDQ15759
PDB Structure3GP0.    
FunctionKinase involved in a signal transduction pathway that is activated by changes in the osmolarity of the extracellular environment, by cytokines, or by environmental stress. Phosphorylates preferentially transcription factor atf2.    
SequenceMSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL EIEQ
Target ValidationClick to Find Target Validation Information.    
Inhibitor4,5,6,7-tetrabromobenzotriazole[2]
BIRB796[3]
BISINDOLYLMALEIMIDE IX[4]
BMS-640994[5]
CI-1040,   PD-18435,   PD-184352[4]
GF-109203[4]
Go-6976[4]
KN-62[4]
KT-5720[4]
L-779450[6]
LY-294002[4]
ML-3163[7]
ML-3375[8]
ML-3403[8]
PD-98059[4]
RO-316233[4]
RWJ-68354[9]
SB 235699[1]
SB-202190[4]
SB-203580[3]
SCIO469[1]
SK&F-86002,   SK-86002[7]
STAUROSPORINONE[4]
U-0126[4]
VK-19911[10]
Vertex 745 (VX745)[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Pharmacological inhibitors of MAPK pathways. Trends Pharmacol Sci. 2002 Jan;23(1):40-5. To Reference
Ref 2J Med Chem. 2004 Dec 2;47(25):6239-47.Optimization of protein kinase CK2 inhibitors derived from 4,5,6,7-tetrabromobenzimidazole. To Reference
Ref 3J Med Chem. 2008 Jul 24;51(14):4122-49. Epub 2008 Jun 26.Design, synthesis, and biological evaluation of novel Tri- and tetrasubstituted imidazoles as highly potent and specific ATP-mimetic inhibitors of p38 MAP kinase: focus on optimized interactions with the enzyme's surface-exposed front region. To Reference
Ref 4Biochem J. 2000 Oct 1;351(Pt 1):95-105.Specificity and mechanism of action of some commonly used protein kinase inhibitors. To Reference
Ref 5Bioorg Med Chem Lett. 2008 Mar 15;18(6):1762-7. Epub 2008 Feb 16.The discovery of (R)-2-(sec-butylamino)-N-(2-methyl-5-(methylcarbamoyl)phenyl) thiazole-5-carboxamide (BMS-640994)-A potent and efficacious p38alpha MAP kinase inhibitor. To Reference
Ref 6Bioorg Med Chem Lett. 2006 Jan 15;16(2):378-81. Epub 2005 Nov 2.The identification of potent and selective imidazole-based inhibitors of B-Raf kinase. To Reference
Ref 7J Med Chem. 2002 Jun 20;45(13):2733-40.From imidazoles to pyrimidines: new inhibitors of cytokine release. To Reference
Ref 8J Med Chem. 2003 Jul 17;46(15):3230-44.Novel substituted pyridinyl imidazoles as potent anticytokine agents with low activity against hepatic cytochrome P450 enzymes. To Reference
Ref 9Bioorg Med Chem Lett. 2003 Feb 10;13(3):347-50.Imidazopyrimidines, potent inhibitors of p38 MAP kinase. To Reference
Ref 10J Med Chem. 2003 Dec 18;46(26):5651-62.Synthesis and structure-activity relationship of aminobenzophenones. A novel class of p38 MAP kinase inhibitors with high antiinflammatory activity. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543