Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00355

Target Information
NamePeptidyl-prolyl cis-trans isomerase NIMA-interacting 1    
Type of targetResearch target    
SynonymsPPIase Pin1    
Peptidyl prolyl cis/trans isomerase Pin1    
Prolyl isomerase Pin1    
Rotamase Pin1    
DiseaseAlzheimer's disease
[ICD9: 331.0   ICD10: G30]
[1]
Cancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[2]
Hepatocellular carcinoma
[ICD9: 155   ICD10: C22.0]
[3]
BioChemical ClassCis-trans-Isomerases    
EC NumberEC 5.2.1.8
UniProt IDQ13526
PDB Structure1F8A; 1I8G; 1I8H; 1NMV; 1PIN; 1ZCN; 2F21.    
FunctionEssential ppiase that regulates mitosis presumably by interacting with nima and attenuating its mitosis-promoting activity. Displays a preference for an acidic residue n-terminal to the isomerized proline bond. Catalyzing pser/thr-pro cis/trans isomerization.    
SequenceMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Target ValidationClick to Find Target Validation Information.    
Inhibitor (R)-2-[4]
(R)-2-[4]
(R)-2-[4]
(R)-3-[4]
(R,)-2-[4]
3,6,9,12,15,18-HEXAOXAICOSANE[5]
Ac-Bth-Thr (PO3H2)-Pip-Nal-Gln-NH2[6]
Ac-Phe-D-Thr (PO3H2)-Pip-Nal-Gln-NH2[6]
Ac-Phe-Thr (PO3H2)-Pip-Nal-Gln-NH2[6]
Beta- (2-Naphthyl)-Alanine[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Pin1: a therapeutic target in Alzheimer neurodegeneration. J Mol Neurosci. 2002 Dec;19(3):275-87. To Reference
Ref 2Prolyl isomerase Pin1: a catalyst for oncogenesis and a potential therapeutic target in cancer. J Cell Sci. 2003 Mar 1;116(Pt 5):773-83. To Reference
Ref 3PIN1 overexpression and beta-catenin gene mutations are distinct oncogenic events in human hepatocellular carcinoma. Oncogene. 2004 May 20;23(23):4182-6. To Reference
Ref 4Bioorg Med Chem Lett. 2010 Apr 1;20(7):2210-4. Epub 2010 Feb 14.Structure-based design of novel human Pin1 inhibitors (II). To Reference
Ref 5Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 6J Med Chem. 2006 Apr 6;49(7):2147-50.Nanomolar inhibitors of the peptidyl prolyl cis/trans isomerase Pin1 from combinatorial peptide libraries. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543