Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00361

Target Information
NameBeta-ketoacyl-ACP synthase III    
Type of targetResearch target    
Synonyms3-oxoacyl-[acyl-carrier-protein] synthase III    
Acetoacetyl-ACP synthase    
Acetoacetyl-acyl carrier protein synthase    
Beta-ketoacyl-acyl carrier protein synthase III    
Condensing enzyme FabH    
EcFabH    
FabH    
KAS III    
DiseaseBacterial infections
[ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104   ICD10: A00-A09, A15-A19, A20-A28, A30-A49, A65-A69, A70-A74, A75-A79]
[1][2][3]
Malaria
[ICD9: 084   ICD10: B50-B54]
[4][5]
EC NumberEC 2.3.1.41
UniProt IDO77078
P24249
PDB Structure1EBL; 1HN9; 1HND; 1HNH; 1HNJ; 1HNK; 1MZS; 2EFT.    
FunctionCatalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-acp. Catalyzes the first condensation reaction which initiates fatty acid synthesis.    
SequenceMFLYFITYLCIFHNNIYSVELIKNNKYNFINNVHNIKYRTKIRAIYGKTGGKIIGHGHSY PSTEIYNDELKKYVDTNDEWIRTRTGIKKRRILKRDENISMLQIDSATQALETSCLKPSD IDMVINASSTPQNLFGDANNISNKIGCKNSVNMDLTAACTGFIFAFVTAYNFLNRYKNIL IVGSDALSNFVDWRDRNTCVLFGDAAGAVVLQRTEEKEENKIFNYYLGSDSELNDLLTIN FDHDKYNLDKPNVNKYGKLYMNGKEVFKYTISNIPKILKKAIQHSNINIEDINYFIFHQA NIRIIETVAKNLNIPMSKVLVNLDEYANTSAASIPLCFSENIKNGKIKTNDIICMCGFGA GMSYGCVILKY
Related US Patent6,498,187
6,559,179
6,608,059
6,670,388
6,723,749
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor2- (3-Phenoxy-benzoylamino)-benzoic acid[6]
2- (4-Bromo-3-phenoxy-benzoylamino)-benzoic acid[6]
2- (4-Fluoro-3-phenoxy-benzoylamino)-benzoic acid[6]
2- (4-chlorophenylsulfonyl)naphthalene-1,4-diol[7]
2- (4-propylphenylsulfonyl)naphthalene-1,4-diol[7]
2- (methylsulfonyl)naphthalene-1,4-diol[7]
2- (naphthalen-2-ylsulfonyl)naphthalene-1,4-diol[7]
2- (p-tolylthio)naphthalene-1,4-dione[7]
2- (phenylsulfonyl)naphthalene-1,4-diol[7]
2-Fluoro-6- (3-phenoxy-benzoylamino)-benzoic acid[6]
2-Hydroxy-6- (3-phenoxy-benzoylamino)-benzoic acid[6]
2-Tosylnaphthalene-1,4-diol[7]
2-[3- (Pyridin-4-yloxy)-benzoylamino]-benzoic acid[6]
2-tosylanthracene-1,4-diol[7]
2-tosylbenzene-1,4-diol[7]
2-tosylnaphthalene[7]
2-tosylnaphthalene-1,4-dione[7]
BinderThiolactomycin[4]
Thiolactomycin[8]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Lipid biosynthesis as a target for antibacterial agents. Prog Lipid Res. 2001 Nov;40(6):467-97. To Reference
Ref 2Crystal structure of the Mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase III. J Biol Chem. 2001 Jun 8;276(23):20516-22. Epub 2001 Mar 8. To Reference
Ref 3Acetoacetyl-acyl carrier protein synthase. A target for the antibiotic thiolactomycin. J Biol Chem. 1989 May 5;264(13):7624-9. To Reference
Ref 4The apicoplast as an antimalarial drug target. Drug Resist Updat. 2001 Jun;4(3):145-51. To Reference
Ref 5Novel molecular targets for antimalarial drug development. Chem Biol Drug Des. 2008 Apr;71(4):287-97. Epub 2008 Feb 22. To Reference
Ref 6J Med Chem. 2005 Mar 10;48(5):1596-609.Structure-based design, synthesis, and study of potent inhibitors of beta-ketoacyl-acyl carrier protein synthase III as potential antimicrobial agents. To Reference
Ref 7Bioorg Med Chem Lett. 2008 Dec 15;18(24):6402-5. Epub 2008 Oct 25.Synthesis and biological evaluation of novel sulfonyl-naphthalene-1,4-diols as FabH inhibitors. To Reference
Ref 8Novel molecular targets for antimalarial chemotherapy. Int J Antimicrob Agents. 2007 Jul;30(1):4-10. Epub 2007 Mar 6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543