Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00407

Target Information
NameKinin B1 receptor    
Type of targetResearch target    
SynonymsB(1) receptor    
B1 bradykinin receptor    
B1R    
BK-1 receptor    
KB1    
Kinin B(1) receptor    
DiseaseAnalgesics
[ICD9: 338   ICD10: R52]
[1]
Inflammatory diseases[2]
Inflammatory pain
[ICD9: 338,780   ICD10: R52, G89]
[3]
Pain, unspecified
[ICD9: 338,780   ICD10: R52, G89]
[1]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Complement and coagulation cascades
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
UniProt IDP97583
FunctionThis is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.    
SequenceMASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSF FLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLC RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSI PTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLR GQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEIT DLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Related US Patent6,479,515
6,500,831
6,531,480
AntagonistAc-Lys-[Leu (8)]-des-Arg[4]
B-9858[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Hypoalgesia and altered inflammatory responses in mice lacking kinin B1 receptors. Proc Natl Acad Sci U S A. 2000 Jul 5;97(14):8140-5. To Reference
Ref 2Altered neutrophil homeostasis in kinin B1 receptor-deficient mice. Biol Chem. 2001 Jan;382(1):91-5. To Reference
Ref 3Evidence for the participation of kinins in Freund's adjuvant-induced inflammatory and nociceptive responses in kinin B1 and B2 receptor knockout mice. Neuropharmacology. 2001 Dec;41(8):1006-12. To Reference
Ref 4Non-competitive pharmacological antagonism at the rabbit B(1) receptor. Br J Pharmacol. 2000 Nov;131(5):885-92. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543