Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00447

Target Information
NameCathepsin D    
Type of targetResearch target    
SynonymsCD    
DiseaseAlzheimer's disease
[ICD9: 331.0   ICD10: G30]
[1]
Breast cancer
[ICD9: 174, 175   ICD10: C50]
[2]
BioChemical ClassHydrolases acting on peptide bonds (Peptidases)    
EC NumberEC 3.4.23.5
PathwayLysosome
UniProt IDP07339
PDB Structure1LYA; 1LYB; 1LYW.    
FunctionAcid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly alzheimer's disease.    
SequenceMQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Related US Patent6,326,393
6,432,933
Target ValidationClick to Find Target Validation Information.    
Inhibitor1h-Benoximidazole-2-Carboxylic Acid[3]
Alpha-D-Mannose[3]
CI-992[4]
Carbocyclic Peptidomimetic[5]
GRASSYSTATIN A[6]
GRL-7234[7]
KNI-10006[8]
N-Aminoethylmorpholine[3]
PEPSTATIN A[9]
S-Methylcysteine[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Cleavage at the amino and carboxyl termini of Alzheimer's amyloid-beta by cathepsin D. J Biol Chem. 1994 Jul 15;269(28):18422-8. To Reference
Ref 2How to target estrogen receptor-negative breast cancer? Endocr Relat Cancer. 2003 Jun;10(2):261-6. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 4J Med Chem. 1992 Jul 10;35(14):2562-72.Structure-activity relationships of a series of 2-amino-4-thiazole-containing renin inhibitors. To Reference
Ref 5J Med Chem. 2005 Aug 11;48(16):5175-90.Structure-based design, synthesis, and memapsin 2 (BACE) inhibitory activity of carbocyclic and heterocyclic peptidomimetics. To Reference
Ref 6J Med Chem. 2009 Sep 24;52(18):5732-47.Grassystatins A-C from marine cyanobacteria, potent cathepsin E inhibitors that reduce antigen presentation. To Reference
Ref 7J Med Chem. 2007 May 17;50(10):2399-407. Epub 2007 Apr 14.Design, synthesis, and X-ray structure of potent memapsin 2 (beta-secretase) inhibitors with isophthalamide derivatives as the P2-P3-ligands. To Reference
Ref 8Bioorg Med Chem. 2009 Aug 15;17(16):5933-49. Epub 2009 Jul 3.alpha-Substituted norstatines as the transition-state mimic in inhibitors of multiple digestive vacuole malaria aspartic proteases. To Reference
Ref 9J Med Chem. 1986 Oct;29(10):2088-93.Design and synthesis of a potent and specific renin inhibitor with a prolonged duration of action in vivo. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543