Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00459

Target Information
NamemRNA of Telomerase reverse transcriptase    
Type of targetResearch target    
SynonymsTP2    
Telomerase catalytic subunit    
Telomerase-associated protein 2    
hEST2    
hTERT    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
Lung cancer
[ICD9: 162   ICD10: C33-C34]
[2]
Prostate carcinoma
[ICD9: 185   ICD10: C61]
[3]
Tumors
[ICD9: 140-199, 210-229   ICD10: C00-C75, C7A, C7B, D10-D36, D3A]
[4]
BioChemical ClassTransferases transferring phosphorus-containing groups    
EC NumberEC 2.7.7.-
UniProt IDO14746
PDB Structure2BCK.    
FunctionTelomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. It elongates telomeres. It is a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence.    
SequenceMPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Target ValidationClick to Find Target Validation Information.    
Inhibitor1,3-bis (3,4-dihydroxyphenyl)prop-2-en-1-one[5]
2,3-Dimethylnaphtho[2,3-f]quinoxaline-7,12-dione[6]
2,7-Bis (3-chloropropionamido)anthraquinone[7]
2,7-Bis (4-chlorobutyramido)anthraquinone[7]
2,7-Bis (acetamido)anthraquinone[7]
2,7-Bis (benzoamido)anthraquinone[7]
2,7-Bis (butyramido)anthraquinone[7]
2,7-Bis (chloroacetamido)anthraquinone[7]
2,7-Bis (cyclohexanecarbonamido)anthraquinone[7]
2,7-Bis (cyclopentanecarbonamido)anthraquinone[7]
2,7-Bis (cyclopropanecarbonamido)anthraquinone[7]
2,7-Bis (phenylacetamido)anthraquinone[7]
2,7-Bis (phenylpropionamido)anthraquinone[7]
2,7-Bis (propionamido)anthraquinone[7]
2,7-Bis[2- (butylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (diethylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (dimethylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (ethylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (isobutylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (isopropylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (piperazino)acetamido]anthraquinone[7]
2,7-Bis[2- (piperidino)acetamido]anthraquinone[7]
2,7-Bis[2- (propylamino)acetamido]anthraquinone[7]
2,7-Bis[2- (pyrrolidino)acetamido]anthraquinone[7]
2,7-Bis[3- (butylamino)propionamido]anthraquinone[7]
2,7-Bis[3- (ethylamino)propionamido]anthraquinone[7]
2,7-Bis[3- (piperazino)propionamido]anthraquinone[7]
2,7-Bis[3- (piperidino)propionamido]anthraquinone[7]
2,7-Bis[3- (propylamino)propionamido]anthraquinone[7]
2,7-Bis[3- (pyrrolidino)propionamido]anthraquinone[7]
2,7-Dinitroantraquinone[7]
2,7-diaminoanthraquinone[7]
2-Butyl-1 (3)H-anthra[1,2-d]imidazole-6,11-dione[6]
2-Heptyl-1 (3)H-anthra[1,2-d]imidazole-6,11-dione[6]
2-Methyl-1 (3)H-anthrasimidazole-6,11-dione[6]
7,8,3',4'-tetrahydroxyflavone[5]
AURASPERONE A[8]
HOE-33258[9]
LIVIDOMYCIN A[9]
NSC-745794[6]
NSC-745795[6]
NSC-745796[6]
NSC-745797[6]
NSC-745798[6]
NSC-745799[6]
NSC-745883[6]
NSC-745884[6]
NSC-745885[6]
NSC-745886[6]
NSC-745887[6]
NSC-745888[6]
AntisenseCantide + 5-FU[10]
Cantide + Cisplatin[10]
Cantide + adriamycin[10]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Characterization of HLA-A3-restricted cytotoxic T lymphocytes reactive against the widely expressed tumor antigen telomerase. Clin Cancer Res. 2001 Nov;7(11):3343-8. To Reference
Ref 2Inhibition of anti-sense human telomerase reverse transcriptase (hTERT) retroviral vector on lung cancer cells. Ai Zheng. 2004 May;23(5):545-9. To Reference
Ref 3Expression of telomerase subunits in normal and neoplastic prostate epithelial cells isolated by laser capture microdissection. Cancer. 2001 Oct 1;92(7):1943-8. To Reference
Ref 4Human telomerase reverse transcriptase as a novel target for tumor immunotherapy. Ai Zheng. 2003 Aug;22(8):893-5. To Reference
Ref 5J Med Chem. 2004 Dec 16;47(26):6466-75.Catecholic flavonoids acting as telomerase inhibitors. To Reference
Ref 6Bioorg Med Chem. 2009 Nov 1;17(21):7418-28. Epub 2009 Sep 23.Synthesis, cytotoxicity and human telomerase inhibition activities of a series of 1,2-heteroannelated anthraquinones and anthra[1,2-d]imidazole-6,11-dione homologues. To Reference
Ref 7Bioorg Med Chem. 2008 Jul 15;16(14):6976-86. Epub 2008 Jun 2.Synthesis, human telomerase inhibition and anti-proliferative studies of a series of 2,7-bis-substituted amido-anthraquinone derivatives. To Reference
Ref 8J Nat Prod. 2003 Jan;66(1):136-9.New dimeric naphthopyrones from Aspergillus niger. To Reference
Ref 9Bioorg Med Chem Lett. 2004 Jul 5;14(13):3467-71.Nucleic acid-binding ligands identify new mechanisms to inhibit telomerase. To Reference
Ref 10Design and development of antisense drugs. Expert Opin. Drug Discov. 2008 3(10):1189-1207 To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543