Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00482

Target Information
NameIgG receptor FcRN large subunit P51    
Type of targetResearch target    
SynonymsFcRn    
IgG Fc fragment receptor transporter, alpha chain    
MHC class I family-like Fc receptor    
Neonatal Fc receptor    
Neonatal FcR    
DiseaseAutoimmune diseases
[ICD9: 279.4   ICD10: D84.9, M35.9]
[1][2]
BioChemical ClassTransmembrane protein    
UniProt IDP55899
PDB Structure1EXU; 3M17; 3M1B.    
FunctionBinds to the fc region of monomeric immunoglobulins gamma. Mediates the uptake of igg from milk. Possible role in transfer of immunoglobulin g from mother to fetus.    
SequenceMGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLS YNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCE LGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLF SCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGL AAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV VGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNV IPATA
Target ValidationClick to Find Target Validation Information.    
InhibitorSYN-1327[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1The MHC class I-like IgG receptor controls perinatal IgG transport, IgG homeostasis, and fate of IgG-Fc-coupled drugs. J Immunol. 2003 Apr 1;170(7):3528-33. To Reference
Ref 2The MHC class I-like Fc receptor promotes humorally mediated autoimmune disease. J Clin Invest. 2004 May;113(9):1328-33. To Reference
Ref 3Bioorg Med Chem. 2008 Jun 15;16(12):6394-405. Epub 2008 May 6.Structure-activity relationships of a peptide inhibitor of the human FcRn:human IgG interaction. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543