Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00529

Target Information
NameAdenosine kinase    
Type of targetResearch target    
SynonymsAK    
Adenosine 5'-phosphotransferase    
DiseaseAnalgesics
[ICD9: 338   ICD10: R52]
[1]
Central and peripheral nervous system diseases
[ICD9: 320-389   ICD10: G00-G99]
[1]
Epilepsy
[ICD9: 345   ICD10: G40]
[1]
Inflammation[1]
Inflammatory bowel disease
[ICD9: 555, 556   ICD10: K50, K51]
[2]
Pain, unspecified
[ICD9: 338,780   ICD10: R52, G89]
[1]
Toxoplasmosis
[ICD9: 130   ICD10: B58]
[3][4]
BioChemical ClassTransferases transferring phosphorus-containing groups    
EC NumberEC 2.7.1.20
PathwayMetabolic pathways
Purine metabolism
UniProt IDP55263
PDB Structure1BX4; 2I6A; 2I6B.    
FunctionAtp dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides.    
SequenceMAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD FH
Target ValidationClick to Find Target Validation Information.    
Inhibitor5'-iodotubercidin[5]
5-iodo,5'-deoxytubercidin[6]
6-Benzylthioinosine[7]
GP515[2]
Iodotubercidin
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Nonnucleoside inhibitors of adenosine kinase. Curr Pharm Des. 2004;10(10):1093-103. To Reference
Ref 2Adenosine kinase inhibitor GP515 improves experimental colitis in mice. J Pharmacol Exp Ther. 2001 Jan;296(1):99-105. To Reference
Ref 36-Benzylthioinosine analogues as subversive substrate of Toxoplasma gondii adenosine kinase: activities and selective toxicities. Biochem Pharmacol. 2005 May 15;69(10):1409-19. To Reference
Ref 4Synthesis, biological activity and molecular modeling of 6-benzylthioinosine analogues as subversive substrates of Toxoplasma gondii adenosine kinase. J Med Chem. 2004 Apr 8;47(8):1987-96. To Reference
Ref 5Inhibition of adenosine kinase attenuates interleukin-1- and lipopolysaccharide-induced alterations in articular cartilage metabolism. Osteoarthritis Cartilage. 2005 Mar;13(3):250-7. To Reference
Ref 6J Med Chem. 2006 Nov 16;49(23):6726-31.Crystal structures of human adenosine kinase inhibitor complexes reveal two distinct binding modes. To Reference
Ref 7Bioorg Med Chem. 2010 May 15;18(10):3403-12. Epub 2010 Apr 8.Structure-activity relationships of carbocyclic 6-benzylthioinosine analogues as subversive substrates of Toxoplasma gondii adenosine kinase. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543