Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00538

Target Information
NameEpidermal growth factor receptor III    
Type of targetResearch target    
SynonymsEpidermal growth factor receptor isoform 3    
Mus musculus adult male liver cDNA, RIKEN full-length enriched library, clone:1300003K07 product:epidermal growth factor receptor, full insert sequence    
Mus musculus adult male liver cDNA, RIKEN full-length enriched library, clone:1300005M11 product:epidermal growth factor receptor, full insert sequence    
Mus musculus adult male liver cDNA, RIKEN full-length enriched library, clone:1300008I23 product:epidermal growth factor receptor, full insert sequence    
DiseaseBrain tumors
[ICD9: 191, 225.0   ICD10: C71, D33]
[1]
PathwayAdherens junction
Bladder cancer
Calcium signaling pathway
Colorectal cancer
Cytokine-cytokine receptor interaction
Endometrial cancer
ErbB signaling pathway
Focal adhesion
Gap junction
Glioma
GnRH signaling pathway
MAPK signaling pathway
Melanoma
Non-small cell lung cancer
Pancreatic cancer
Pathways in cancer
Prostate cancer
Regulation of actin cytoskeleton
UniProt IDQ9WVF5
SequenceMRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGYVQWQWILKTFWI
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1EGFRvIII as a promising target for antibody-based brain tumor therapy. Brain Tumor Pathol. 2000;17(2):71-8. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543