Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00545

Target Information
NameLeukotriene B4 receptor 2    
Type of targetResearch target    
SynonymsLTB4 receptor JULF2    
LTB4-R2    
Leukotriene B(4) receptor BLT2    
Leukotriene B4 receptor BLT2    
Seven transmembrane receptor BLTR2    
DiseaseImmunological disorders[1]
Inflammation[1]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDQ9NPC1
FunctionLow-affinity receptor for leukotrienes including leukotriene b4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via g-proteins that activate a phosphatidylinositol-calcium second messenger system.    
SequenceMAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Related US Patent6,133,286
6,160,012
6,291,531
6,340,706
6,576,669
6,583,177
6,617,345
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor (3S,4R)-3-Benzyl-7-isopropyl-chroman-4-ol[2]
CP-105696[2]
LEUKOTRIENE_B4[3]
LY-255283[4]
LY-255283[3]
LY-282210[5]
LY-292728[5]
SC-41390[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1A second leukotriene B(4) receptor, BLT2. A new therapeutic target in inflammation and immunological disorders. J Exp Med. 2000 Aug 7;192(3):421-32. To Reference
Ref 2Bioorg. Med. Chem. Lett. 7(17):2307-2312 (1997) To Reference
Ref 3Bioorg. Med. Chem. Lett. 3(10):1985-1990 (1993) To Reference
Ref 4J Med Chem. 1993 Nov 26;36(24):3978-81.o-phenylphenols: potent and orally active leukotriene B4 receptor antagonists. To Reference
Ref 5J Med Chem. 1993 Nov 26;36(24):3982-4.Biphenylyl-substituted xanthones: highly potent leukotriene B4 receptor antagonists. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543