Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00565

Target Information
Name5-hydroxytryptamine 5A receptor    
Type of targetResearch target    
Synonyms5-HT 5A    
5-HT-5    
5-HT-5A    
Serotonin receptor    
Serotonin receptor 5A    
DiseaseBipolar affective disorder
[ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8   ICD10: F31]
[1]
Depression
[ICD9: 311   ICD10: F32]
[1]
Schizophrenia
[ICD9: 295   ICD10: F20]
[1]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDP47898
FunctionThis is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins.    
SequenceMDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Target ValidationClick to Find Target Validation Information.    
Inhibitor (+/-)-nantenine[2]
3,4-dihydroquinazolin-2-amine hydrobromide[3]
4-ethyl-3,4-dihydroquinazolin-2-amine[3]
4-methyl-N-propyl-3,4-dihydroquinazolin-2-amine[4]
4-propyl-3,4-dihydroquinazolin-2-amine[3]
5,6-dichloro-3,4-dihydroquinazolin-2-amine[3]
5-chloro-3,4-dihydroquinazolin-2-amine[3]
5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine[3]
5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine[3]
8-chloro-3,4-dihydroquinazolin-2-amine[3]
8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine[3]
METHIOTHEPIN[5]
N,4-dimethyl-3,4-dihydroquinazolin-2-amine[4]
N,N-dimethyl-3,4-dihydroquinazolin-2-amine[3]
N-butyl-4-methyl-3,4-dihydroquinazolin-2-amine[4]
SEROTONIN[6]
ZACOPRIDE[5]
AntagonistSB-699551-A[7]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Association analysis of the 5-HT5A gene in depression, psychosis and antipsychotic response. Neuroreport. 2000 Jun 26;11(9):2017-20. To Reference
Ref 2Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. To Reference
Ref 3Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. To Reference
Ref 4Bioorg Med Chem Lett. 2008 Jan 1;18(1):262-6. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: optimising brain penetration. To Reference
Ref 5J Med Chem. 2003 Jul 3;46(14):2795-812.Higher-end serotonin receptors: 5-HT(5), 5-HT(6), and 5-HT(7). To Reference
Ref 6J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. To Reference
Ref 75-ht5A receptors as a therapeutic target. Pharmacol Ther. 2006 Sep;111(3):707-14. Epub 2006 Mar 6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543