Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00571

Target Information
NameDipeptidyl-peptidase I    
Type of targetResearch target    
SynonymsCathepsin C    
Cathepsin J    
Cysteine protease dipeptidyl peptidase I    
DPP-I    
DPPI    
Dipeptidyl peptidase I    
Dipeptidyl transferase    
DiseaseAlzheimer's disease
[ICD9: 331.0   ICD10: G30]
[1]
Sepsis
[ICD9: 995.91   ICD10: A40, A41]
[2]
BioChemical ClassHydrolases acting on peptide bonds (Peptidases)    
EC NumberEC 3.4.14.1
UniProt IDP53634
PDB Structure1K3B; 2DJF; 2DJG; 3PDF.    
FunctionThiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Activates serine proteases such as elastase, cathepsin g and granzymes a and b. Can also activate neuramindase and factor xiii.    
SequenceMGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQ EKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNE TMTGWVHDVLGRNWACFTGKKVGTASENVYVNTAHLKNSQEKYSNRLYKYDHNFVKAINA IQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNV HGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEG GFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALM KLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGM DYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Target ValidationClick to Find Target Validation Information.    
Inhibitor (S)-2-amino-N-[3]
GNF-PF-5434[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 2Mast cell dipeptidyl peptidase I mediates survival from sepsis. J Clin Invest. 2004 Feb;113(4):628-34. To Reference
Ref 3Bioorg Med Chem Lett. 2006 Jul 1;16(13):3614-7. Epub 2006 May 2.Dipeptidyl nitriles as human dipeptidyl peptidase I inhibitors. To Reference
Ref 4Bioorg Med Chem. 2009 Feb 1;17(3):1064-70. Epub 2008 Feb 7.Substrate optimization for monitoring cathepsin C activity in live cells. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543