Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00587

Target Information
NameEstradiol 17 beta-dehydrogenase 1    
Type of targetResearch target    
Synonyms17-beta-HSD 1    
17-beta-Hydroxysteroid dehydrogenase type 1    
20 alpha-hydroxysteroid dehydrogenase    
20-alpha-HSD    
E2DH    
Placental 17-beta-hydroxysteroid dehydrogenase    
DiseaseBreast cancer (hormone-sensitive)
[ICD9: 140-229, 174, 175   ICD10: C00-C96, C50]
[1]
BioChemical ClassOxidoreductases acting on the CH-OH group of donors    
EC NumberEC 1.1.1.62
PathwayAndrogen and estrogen metabolism
Metabolic pathways
UniProt IDP14061
PDB Structure1A27; 1BHS; 1DHT; 1EQU; 1FDS; 1FDT; 1FDU; 1FDV; 1FDW; 1I5R; 1IOL; 1JTV; 1QYV; 1QYW; 1QYX; 3DEY; 3DHE; 3HB4; 3HB5; 3KLM; 3KLP; 3KM0.    
FunctionFavors the reduction of estrogens and androgens. Also has 20-alpha-hsd activity. Uses preferentially NADH.    
SequenceMARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG GAGPGAEDEAGRSAVGDPELGDPPAAPQ
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor1,1':4',1''-terphenyl-3,3''-diol[2]
1,1':4',1''-terphenyl-3,4''-diol[2]
1-Bromo-6- (3-hydroxyphenyl)-2-naphthol[3]
16- (2',2'-Dimethyl)-propylidene-estradiol[4]
16- (2',2'-Dimethyl)-propylidene-estrone[4]
16- (4-cyano-benzylidene)-estradiol[4]
16- (4-dimethylamino-benzylidene)-estradiol[4]
16- (4-dimethylamino-benzylidene)-estrone[4]
16- (pyridin-2-yl)methyl-estradiol[4]
16- (pyridin-2-yl)methylene-estradiol[4]
16- (pyridin-3-yl)methyl-estradiol[4]
16- (pyridin-3-yl)methylene-estradiol[4]
16- (pyridin-4-yl)methyl-estradiol[4]
16- (pyridin-4-yl)methylene-estradiol[4]
16- (thiophen-2-yl)methylene-estrone[4]
16-beta-ethoxymethyl-estrone[4]
16-beta-hydroxymethyl-estradiol[4]
16-isobutylidene-estradiol[4]
16-isobutylidene-estrone[4]
16beta-cyano-estradiol[4]
2'-Monophosphoadenosine 5'-Diphosphoribose[5]
2- (3-hydroxyphenyl)quinolin-6-ol[6]
2-Fluoro-4-[5- (3-hydroxyphenyl)-2-thienyl]phenol[2]
2-Fluoro-4-[5- (3-hydroxyphenyl)-3-thienyl]phenol[2]
2-Fluoro-5-[5- (4-hydroxyphenyl)-2-thienyl]phenol[2]
2-Hydroxy-N,6-bis (3-hydroxyphenyl)-1-naphthamide[3]
3'- (1-Benzothien-2-yl)biphenyl-3-ol[7]
3'- (5-Chloro-2-thienyl)biphenyl-3-ol[7]
3,3',3''-Thiene-2,3,5-triyltriphenol[2]
3,3'- (1,2,4,5-tetrazine-3,6-diyl)diphenol[8]
3,3'- (1,2,4-Thiadiazol-2,5-diyl)diphenol[8]
3,3'- (1,2,4-thiadiazole-3,5-diyl)diphenol[8]
3,3'- (1,3-Thiazol-2,4-diyl)diphenol[8]
3,3'- (3-Methylthiene-2,5-diyl]diphenol[2]
3,3'- (3-Phenylthiene-2,5-diyl)diphenol[2]
3,3'-Pyridine-2,5-diyldiphenol[8]
3,3'-Thiene-2,4-diyldiphenol[8]
3,3'-pyrazine-2,5-diyldiphenol[8]
3,3'-thiene-2,5-diyldiphenol[2]
3,3- (1,3-Thiazole-2,5-diyl)diphenol[8]
3,4'- (thiophene-2,4-diyl)diphenol[2]
3- (2-naphthyl)phenol[6]
3- (3-hydroxyphenyl)quinolin-7-ol[6]
3- (5-phenyl-2-thienyl)phenol[2]
3- (6-hydroxy-2-naphthyl)benzoic acid[6]
3-Beta-Hydroxy-5-Androsten-17-One[5]
3-Fluoro-5-[5- (4-hydroxyphenyl)-2-thienyl]phenol[2]
3-Hydroxy-7- (3-hydroxyphenyl)-1-naphthonitrile[3]
3-[2- (5-Chloro-2-thienyl)pyridin-4-yl]phenol[7]
3-[3- (4-hydroxyphenyl)isoxazol-5-yl]phenol[9]
3-[4- (4-Hydroxyphenyl)-1,3-oxazol-2-yl]phenol[9]
3-[4- (5-Chloro-2-thienyl)pyridin-2-yl]phenol[7]
3-[5- (3,4-Difluorophenyl)-2-thienyl]phenol[2]
3-[5- (3-Fluorophenyl)-2-thienyl]phenol[2]
3-[5- (4-Fluorophenyl)-2-thienyl]phenol[2]
3-[5- (4-Hydroxyphenyl)-2-thienyl]-5-methylphenol[2]
3-[5- (4-Hydroxyphenyl)-3-thienyl]phenol[8]
3-[5- (4-hydroxyphenyl)-1,3-oxazol-2-yl]phenol[8]
3-[5- (4-hydroxyphenyl)-1,3-thiazol-2-yl]phenol[2]
3-[5- (4-hydroxyphenyl)-2-thienyl]phenol[2]
3-[6- (5-Chloro-2-thienyl)pyridin-2-yl]phenol[7]
4'- (5-Chloro-2-thienyl)biphenyl-3-ol[7]
4'- (6-Methoxypyridin-3-yl)biphenyl-3-ol[7]
4-ANDROSTENE-3-17-DIONE[10]
4-Fluoro-1,1':4',1''-terphenyl-3,3''-diol[2]
4-Methyl-1,1':4',1''-terphenyl-3,4''-diol[2]
4-[5- (3-Hydroxyphenyl)-2-thienyl)-2-methyl]phenol[2]
4-[5- (3-Hydroxyphenyl)-2-thienyl]benzene-1,2-diol[2]
4-[5- (3-Hydroxyphenyl)-3-thienyl]-2-methylphenol[2]
5- (6-hydroxy-2-naphthyl)pyridin-3-ol[6]
5alpha-Androstan-3,17-Dione[5]
6- (3-Hydroxyphenyl)-1-phenyl-2-naphthol[3]
6- (3-hydroxyphenyl)-2-naphthol[3]
6- (4-hydroxyphenyl)-1-naphthol[6]
6-oxo-16-formyl-estrone[4]
6-oxo-estrone[4]
7- (3-hydroxyphenyl)-2-naphthol[6]
7-Hydroxy-3- (3-hydroxyphenyl)-1-naphthonitrile[3]
APIGENIN[11]
BVT-14225[12]
BVT-2733[12]
Dihydrotestosterone[13]
EM-1745[5]
Equilin[5]
KAEMPFEROL[11]
N (1'-Phenyl-ethyl) estradiol-16-carboxamide[4]
N (4'-methyl-piperazinyl) estradiol-16-carboxamide[4]
N (furan-2-ylmethyl)-estrone-16-methyl carboxamide[4]
N (pyridin-3-ylmethyl) estradiol-16-carboxamide[4]
N (pyridin-4-ylmethyl) estradiol-16-carboxamide[4]
N,N-diethyl estrone-16-methyl carboxamide[4]
N- (furan-2-ylmethyl)estradiol-16-carboxamide[4]
N-N-diethyl estradiol-16-methyl carboxamide[4]
N-ethyl estradiol-16-methyl carboxamide[4]
N-ethyl estrone-16-methyl carboxamide[4]
N-isopropyl estradiol-16-carboxamide[4]
N-isopropyl estradiol-16-methyl carboxamide[4]
N-isopropyl estrone-16-methyl carboxamide[4]
N-methoxyethyl estrone-16-methyl carboxamide[4]
N-methyl estradiol-16-methyl carboxamide[4]
N-methyl estrone-16-methyl carboxamide[4]
N-methyl-N-ethyl estradiol-16-carboxamide[4]
N-methyl-N-ethyl estrone-16-methyl carboxamide[4]
N-methyl-N-ethyl estrone-16-methyl carboxamide[4]
NARINGENIN[11]
NSC-94258[11]
Nicotinamide-Adenine-Dinucleotide[5]
[1,1',   4',1'']Terphenyl-3,3''-diol[2]
ethyl estrone-16-methylcarboxylate[4]
methyl estradiol-16-beta-carboxylate[4]
Agonist4-Androstenedione[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 117-beta-Hydroxysteroid dehydrogenase type 1: computational design of active site inhibitors targeted to the Rossmann fold. Chem Biol Interact. 2003 Feb 1;143-144:481-91. To Reference
Ref 2J Med Chem. 2009 Nov 12;52(21):6724-43.New insights into the SAR and binding modes of bis(hydroxyphenyl)thiophenes and -benzenes: influence of additional substituents on 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) inhibitory activity and selectivity. To Reference
Ref 3J Med Chem. 2008 Aug 14;51(15):4685-98. Epub 2008 Jul 17.Substituted 6-phenyl-2-naphthols. Potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1): design, synthesis, biological evaluation, and pharmacokinetics. To Reference
Ref 4J Med Chem. 2006 Feb 23;49(4):1325-45.Modification of estrone at the 6, 16, and 17 positions: novel potent inhibitors of 17beta-hydroxysteroid dehydrogenase type 1. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6J Med Chem. 2008 Apr 10;51(7):2158-69. Epub 2008 Mar 7.Design, synthesis, and biological evaluation of (hydroxyphenyl)naphthalene and -quinoline derivatives: potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) for the treatment of estrogen-dependent diseases. To Reference
Ref 7Bioorg Med Chem. 2010 May 15;18(10):3494-505. Epub 2010 Mar 29.Novel estrone mimetics with high 17beta-HSD1 inhibitory activity. To Reference
Ref 8J Med Chem. 2008 Nov 13;51(21):6725-39. Epub 2008 Oct 15.Design, synthesis, biological evaluation and pharmacokinetics of bis(hydroxyphenyl) substituted azoles, thiophenes, benzenes, and aza-benzenes as potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1). To Reference
Ref 9Bioorg Med Chem. 2008 Jun 15;16(12):6423-35. Epub 2008 May 3.Design, synthesis and biological evaluation of bis(hydroxyphenyl) azoles as potent and selective non-steroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) for the treatment of estrogen-dependent diseases. To Reference
Ref 10Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 11J Med Chem. 2008 Jul 24;51(14):4188-99. Epub 2008 Jun 6.Discovery of nonsteroidal 17beta-hydroxysteroid dehydrogenase 1 inhibitors by pharmacophore-based screening of virtual compound libraries. To Reference
Ref 12J Med Chem. 2008 Aug 28;51(16):4851-7. Epub 2008 Jul 22.Blockade of glucocorticoid excess at the tissue level: inhibitors of 11beta-hydroxysteroid dehydrogenase type 1 as a therapy for type 2 diabetes. To Reference
Ref 13Askew EB, Gampe RT Jr, Stanley TB, Faggart JL, Wilson EM: Modulation of androgen receptor activation function 2 by testosterone and dihydrotestosterone. J Biol Chem. 2007 Aug 31;282(35):25801-16. Epub 2007 Jun 25. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543