Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00596

Target Information
NameDeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial    
Type of targetResearch target    
SynonymsDUTP pyrophosphatase    
DUTPase    
Deoxyuridine 5'-triphosphate nucleotidohydrolase    
Deoxyuridine triphosphate nucleotidohydrolase    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
Herpes virus infection
[ICD9: 001-139, 042-075   ICD10: A00-B99, A80-A99, B00-B34]
[2]
Viral infection, unspecified
[ICD9: 001-139, 042-075   ICD10: A00-B99, A80-A99, B00-B34]
[1]
BioChemical ClassHydrolases acting on acid anhydrides    
EC NumberEC 3.6.1.23
PathwayMetabolic pathways
Pyrimidine metabolism
UniProt IDP03195
P06968
P33316
PDB Structure1Q5H; 1Q5U; 2HQU; 3ARA; 3ARN; 3EHW.    
FunctionThis enzyme is involved in nucleotide metabolism: it produces dump, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dutp so that uracil cannot be incorporated into dna.    
SequenceMEACPHIRYAFQNDKLLLQQASVGRLTLVNKTTILLRPMKTTTVDLGLYARPPEGHGLML WGSTSRPVTSHVGIIDPGYTGELRLILQNQRRYNSTLRPSELKIHLAAFRYATPQMEEDK GPINHPQYPGDVGLDVSLPKDLALFPHQTVSVTLTVPPPSIPHHRPTIFGRSGLAMQGIL VKPCRWRRGGVDVSLTNFSDQTVFLNKYRRFCQLVYLHKHHLTSFYSPHSDAGVLGPRSL FRWASCTFEEVPSLAMGDSGLSEALEGRQGRGFGSSGQ
Target ValidationClick to Find Target Validation Information.    
Inhibitor1- (3-tritylaminopropyl)uracil[3]
1-[ (Z)-4-trityloxy-2-butenyl]uracil[3]
1-[2- (trityloxy)ethoxymethyl]uracil[3]
1-[4-hydroxy-3- (tritylaminomethyl)butyl]uracil[3]
2'-Deoxyuridine 5'-Alpha,Beta-Imido-Triphosphate[4]
2'-deoxyuridine 5'-alpha,beta-imido-diphosphate[5]
2'-deoxyuridylic acid[4]
Acetate Ion[4]
Deoxyuridine-5'-Diphosphate[5]
Deoxyuridine-5'-Triphosphate[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Flexible glycine rich motif of Escherichia coli deoxyuridine triphosphate nucleotidohydrolase is important for functional but not for structural integrity of the enzyme. Proteins. 1997 Aug;28(4):568-79. To Reference
Ref 2The herpesvirus encoded dUTPase as a potential chemotherapeutic target. Curr Protein Pept Sci. 2001 Dec;2(4):371-9. To Reference
Ref 3J Med Chem. 2006 Jul 13;49(14):4183-95.Acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. To Reference
Ref 4Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 5Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543