Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00602

Target Information
NameHaemophilus influenzae NadR protein    
Type of targetResearch target    
SynonymsTranscriptional regulator nadR    
DiseaseInfections
[ICD9: 001-139   ICD10: A00-B99]
[1]
PathwayMetabolic pathways
Nicotinate and nicotinamide metabolism
UniProt IDP44308
PDB Structure1LW7.    
FunctionNadr is bifunctional; it interacts with pnuc at low internal nad levels, permitting transport of nmn intact into the cell. As nad levels increase within the cell, the affinity of nadr for the operator regions of some genes increases.    
SequenceMGFTTGREFHPALRMRAKYNAKYLGTKSEREKYFHLAYNKHTQFLRYQEQIMSKTKEKKV GVIFGKFYPVHTGHINMIYEAFSKVDELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRLRW MQQIFKYQKNQIFIHHLVEDGIPSYPNGWQSWSEAVKTLFHEKHFEPSIVFSSEPQDKAP YEKYLGLEVSLVDPDRTFFNVSATKIRTTPFQYWKFIPKEARPFFAKTVAILGGESSGKS VLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQMALGHQRYIDYAVRHSHKI AFIDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFDVTILLKNNTEWVDDGLRSLGSQKQR QQFQQLLKKLLDKYKVPYIEIESPSYLDRYNQVKAVIEKVLNEEEISELQNTTFPIKGTS Q
InhibitorNicotinamide-Adenine-Dinucleotide[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Crystal structure of Haemophilus influenzae NadR protein. A bifunctional enzyme endowed with NMN adenyltransferase and ribosylnicotinimide kinase activities. J Biol Chem. 2002 Sep 6;277(36):33291-9. Epub 2002 Jun 14. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543