Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00659

Target Information
NameBis(5'-adenosyl)-triphosphatase    
Type of targetResearch target    
SynonymsAP3A hydrolase    
AP3AASE    
Diadenosine 5',5'''-P1,P3-triphosphate hydrolase    
Dinucleosidetriphosphatase    
Fragile histidine triad (FHIT) gene    
Fragile histidine triad protein    
DiseaseProstate carcinoma
[ICD9: 185   ICD10: C61]
[1]
BioChemical ClassHydrolases acting on acid anhydrides    
EC NumberEC 3.6.1.29
PathwayNon-small cell lung cancer
Purine metabolism
Small cell lung cancer
UniProt IDP49789
PDB Structure1FHI; 1FIT; 2FHI; 2FIT; 3FIT; 4FIT; 5FIT; 6FIT.    
FunctionCleaves a-5'-ppp-5'a to yield amp and adp. Possible tumor suppressor for specific tissues.    
SequenceMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH DKEDFPASWRSEEEMAAEAAALRVYFQ
InhibitorAdenosine Monotungstate[2]
Ado-P-Ch2-P-Ps-Ado[2]
Fructose[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Down-regulation of fragile histidine triad expression in prostate carcinoma. Cancer. 2003 Mar 15;97(6):1447-52. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543