Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00662

Target Information
NameUDP-glucose 4-epimerase    
Type of targetResearch target    
SynonymsGalactowaldenase    
UDP-galactose 4'-epimerase    
UDP-galactose 4-epimerase    
DiseaseTrypanolytic infections
[ICD9: 001-139   ICD10: A00-B99]
[1]
BioChemical ClassRacemases and Epimerases    
EC NumberEC 5.1.3.2
PathwayAmino sugar and nucleotide sugar metabolism
Galactose metabolism
Metabolic pathways
UniProt IDQ14376
Q8T8E9
PDB Structure1GY8; 2CNB.    
FunctionCatalyzes two distinct but analogous reactions: the epimerization of udp-glucose to udp-galactose and the epimerization of udp-n-acetylglucosamine to udp-n- acetylgalactosamine.    
SequenceMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSV EFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMK AHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRD YIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR EGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Target ValidationClick to Find Target Validation Information.    
InhibitorGlucose-Uridine-C1,5'-Diphosphate[2]
Nicotinamide-Adenine-Dinucleotide[2]
PSAMMAPLIN A[3]
Phenyl-Uridine-5'-Diphosphate[2]
Tetramethylammonium Ion[2]
Uridine Diphosphate Galactose[4]
Uridine-5'-Diphosphate[2]
Uridine-5'-Diphosphate-Mannose[2]
Uridine-Diphosphate-N-Acetylgalactosamine[2]
Uridine-Diphosphate-N-Acetylglucosamine[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1High-resolution crystal structure of Trypanosoma brucei UDP-galactose 4'-epimerase: a potential target for structure-based development of novel trypanocides. Mol Biochem Parasitol. 2003 Feb;126(2):173-80. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 3Bioorg Med Chem Lett. 2006 Nov 15;16(22):5744-7. Epub 2006 Sep 7.Identification of novel inhibitors of UDP-Glc 4'-epimerase, a validated drug target for african sleeping sickness. To Reference
Ref 4Ramakrishnan B, Balaji PV, Qasba PK: Crystal structure of beta1,4-galactosyltransferase complex with UDP-Gal reveals an oligosaccharide acceptor binding site. J Mol Biol. 2002 Apr 26;318(2):491-502. To Reference
Ref 5Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543