Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00716

Target Information
NameFarnesyl-protein transferase    
Type of targetResearch target    
SynonymsFPTase    
FT    
FTase    
Farnesyl Protein Transferase    
Farnesyltransferase    
Protein farnesyltransferase    
Ras protein farnesyltransferase    
DiseaseAmebiasis
[ICD9: 006   ICD10: A06]
[1]
Cancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[2][3][4]
Parasitic diseases[3]
BioChemical ClassTransferases transferring alkyl or aryl groups    
EC NumberEC 2.5.1.-
EC 2.5.1.21
UniProt IDQ76L89
Q76L90
Q9U1N4
SequenceMEIEEVEVETVTSIDQYECQNTVEKEKAYTRYIIRHNFLTYSFNPEIHIKWLTLSIHKPL PSGFMSLDSSTPWILYWTLNPLRLFGYNVDKYLNEYTEALRLITLPDGVIRGSQQSIPIV AGCYSGVCTMIDIGTVNAYQLINRQNTYNFLISKKFPDGSFEMNCDSGDIDTRACYCAIS TAYVLNILDDNLKQGVAEWLLKCQTYEGGFSGCPGGEAHGGYSYCAVAALALLGRIDEID INKLLRWLIQRQKPIEGGFDGRINKLVDACYTFWQASIFGILKKYSKTFQASPVFPNVDK LLDYIILASQNKDGGYRDKPSKKPDLYHTNYALSGISSILHASDHQMKNTIRPIEPAMGV DQFYFDKACEYFRSL
Related US Patent6,265,422
6,335,343
6,342,765
6,358,968
6,369,034
6,376,496
6,387,903
6,399,615
6,410,539
6,429,203
6,436,960
6,440,989
6,451,812
6,458,783
6,458,935
6,492,410
6,498,152
6,511,978
6,528,523
6,528,535
6,541,491
6,545,020
6,602,883
6,624,157
6,632,818
6,645,966
InhibitorTipifarnib[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Molecular cloning and characterization of a protein farnesyltransferase from the enteric protozoan parasite Entamoeba histolytica. J Biol Chem. 2004 Jan 16;279(3):2316-23. Epub 2003 Oct 28. To Reference
Ref 2Ras protein farnesyltransferase: A strategic target for anticancer therapeutic development. J Clin Oncol. 1999 Nov;17(11):3631-52. To Reference
Ref 3Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity. Biochemistry. 2004 Jun 8;43(22):6877-84. To Reference
Ref 4Chemistry and Biology of Cylindrols: Novel Inhibitors of Ras Farnesyl-Protein Transferase from Cylindrocarpon lucidum. J Org Chem. 1996 Nov 1;61(22):7727-7737. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543