Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00747

Target Information
NameFlavohemoglobin    
Type of targetResearch target    
SynonymsDihydropteridine reductase    
Ferrisiderophore reductase B    
HMP    
Hemoglobin-like protein    
NO oxygenase    
NOD    
Nitric oxide dioxygenase    
DiseaseMicrobial infections
[ICD9: 001-139   ICD10: A00-B99]
[1]
BioChemical ClassOxidoreductases acting on paired donors    
EC NumberEC 1.14.12.17
EC 1.5.1.34
EC 1.6.99.7
UniProt IDP24232
PDB Structure1GVH.    
FunctionPossesses dihydropteridine reductase activity. Also has nitric oxide dioxygenase activity.seems to reduces the complexed fe(3+) iron of siderophores to fe(2+), thus releasing it from the chelator.    
SequenceMLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQREALFNA IAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPGQEVLDAW GKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFELEPVDGGAV AEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVG DVVKLVAPAGDFFMAVADDTPVTLISAGVGQTPMLAMLDTLAKAGHTAQVNWFHAAENGD VHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGLMDLSKLEGAFSDPTMQFY LCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKVL
Inhibitor2- (N-Morpholino)-Ethanesulfonic Acid[2]
Flavin-Adenine Dinucleotide[2]
Heme[3]
Nicotinamide-Adenine-Dinucleotide[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Protection from nitrosative stress by yeast flavohemoglobin. Proc Natl Acad Sci U S A. 2000 Apr 25;97(9):4672-6. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 3Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543